Home
Protein
Recombinant Proteins
Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A (mrcA), partial

Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A (mrcA), partial

^{In Stock}

Code	CSB-EP363014NGG
Abbreviation	Recombinant Neisseria meningitidis serogroup B mrcA protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

mrcA

Uniprot No.

P0A0Z6

Research Area

others

Alternative Names

mrcA; ponA; NMB1807; Penicillin-binding protein 1A; PBP-1a; PBP1a) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)]

Species

Neisseria meningitidis serogroup B (strain MC58)

Source

E.coli

Expression Region

206-413aa

Target Protein Sequence

KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.0kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The Recombinant Neisseria meningitidis serogroup B mrcA is a precision-engineered version of the native Penicillin-binding protein 1A found in Neisseria meningitidis serogroup B strain MC58. This product is aimed at providing a robust and reliable protein for your research requirements.

The product is expressed in E.coli, with a defined expression region between the 206-413aa. This results in a partially length protein which is designed to retain the key functional elements of the full protein. To enhance its detection and purification, the protein has been N-terminal 6xHis-SUMO-tagged.

The Recombinant Neisseria meningitidis serogroup B mrcA protein is subjected to rigorous quality control, ensuring a purity of over 90%, as determined by SDS-PAGE. This level of purity guarantees a high-quality product, designed to deliver consistent performance in your experiments.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).

Subcellular Location

Cell inner membrane; Single-pass type II membrane protein.

Protein Families

Glycosyltransferase 51 family; Transpeptidase family

Database Links

KEGG: nme:NMB1807

STRING: 122586.NMB1807

Promotions