Recombinant Aspergillus fumigatus Hydrophobin (rodA)

In Stock
Code CSB-EP340427NGS
Abbreviation Recombinant Aspergillus fumigatus rodA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
rodA
Uniprot No.
Research Area
Others
Alternative Names
rodA; hyp1; AFUA_5G09580; Hydrophobin; Rodlet protein
Species
Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)
Source
E.coli
Expression Region
19-159aa
Target Protein Sequence
LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Neosartorya fumigata Hydrophobin (rodA) with an N-terminal 6xHis-B2M-tag is a full-length of mature protein expressed in E.coli. The sequence used to prepare this recombinant RodA protein corresponds to residues Leu19-Leu159 of Neosartorya fumigata RodA. Its purity is greater than 85% as determined by SDS-PAGE. A molecular mass band of approximately 30 kDa was visualized on the reducing SDS-PAGE gel. Applied for specific antibody synthesis, this recombinant rodA protein also may be used on Aspergillus fumigatus-related studies.

RodA is one of Neosartorya fumigata/Aspergillus fumigatus-expressed hydrophobins, which self-assemble spontaneously into the amphipathic layer at the hydrophilic-hydrophobic interfaces facilitating and supporting the fungal lifecycle at air-water and water-environmental interfaces. As the only needed hydrophobin in A. fumigatus, rodA determines the structure, permeability, hydrophobicity, and immunological inertia of the cell wall surface in conidia and is responsible for rodlet formation, conidiogenesis, resistance to physical insult or anionic dyes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia.
Gene References into Functions
  1. hydrophobin RodAto reduced neutrophil extracellular trap formation of neutrophils encountering Aspergillus fungal elements PMID: 20442864
Subcellular Location
Secreted, cell wall.
Protein Families
Fungal hydrophobin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*