Recombinant Oryza sativa subsp. japonica TPR repeat-containing thioredoxin TDX(Os09g0401200)

In Stock
Code CSB-EP732309OFGb1
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q6ES52
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MATAGASSFEDEIMESDIELEGEAVEPDNDPPQKMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKLDEAIEHLTEAIVLNPTSAIAYATRAVIFVKSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEIGAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEEVSAASAALKDGDVIAIHSSSELDTKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAEKHRNVVFLKVDIDELNSVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS
Research Area Others
Source E.coli
Gene Names Os09g0401200
Expression Region 1-317aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 42.0 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats (By similarity).
Protein Families Thioredoxin family
Database Links

KEGG: osa:4346999

UniGene: Os.15565

Related Products

Os09g0401200 Antibodies

Os09g0401200 Antibodies for Oryza sativa subsp. japonica (Rice)

Os09g0401200 Proteins

Os09g0401200 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.