Home
Protein
Recombinant Proteins
Recombinant Pig Pro-opiomelanocortin (POMC), partial

Recombinant Pig Pro-opiomelanocortin (POMC), partial

Code	CSB-YP355615PI
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP355615PI
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP355615PI-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP355615PI
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP355615PI
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

POMC

Uniprot No.

P01192

Alternative Names

POMC; Pro-opiomelanocortin; POMC; Corticotropin-lipotropin) [Cleaved into: NPP; Melanotropin gamma; Gamma-MSH); Corticotropin; Adrenocorticotropic hormone; ACTH); Melanocyte-stimulating hormone alpha; Alpha-MSH; Melanotropin alpha); Corticotropin-like intermediary peptide; CLIP); Lipotropin beta; Beta-LPH); Lipotropin gamma; Gamma-LPH); Melanocyte-stimulating hormone beta; Beta-MSH; Melanotropin beta); Beta-endorphin; Met-enkephalin]

Species

Sus scrofa (Pig)

Expression Region

27-106

Target Protein Sequence

WCLE SSQCQDLSTE SNLLACIRAC KPDLSAETPV FPGNGDAQPL TENPRKYVMG HFRWDRFGRR NGSSSGGGGG GGGAGQ

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

This protein is only listed on the website as 500ug,1mg, but is it possible that this protein could provide a smaller SIZE?

Thanks for your inquiry. Recombinant Pig Pro-opiomelanocortin(POMC),partial
CSB-YP355615PI >> Yeast
CSB-EP355615PI >> E.coli
CSB-BP355615PI >> Baculovirus
CSB-MP355615PI >> Mammalian cell
regional representation:27-106aa; Fragment
Tag Information:N-terminal 6xHis-tagged
expressed sequences:

WCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQ

The smallest specification is 50ug

Target Background

Function

Stimulates the adrenal glands to release cortisol.; Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; Increases the pigmentation of skin by increasing melanin production in melanocytes.; Endogenous orexigenic opiate.; Endogenous opiate.

Gene References into Functions

Porcine follicular cells (especially granulosa cells) may produce opioid peptides and that gonadotropins may modulate gene expression of their precursors in these cells. PMID: 17023126
The expression of the genes coding for proopiomelanocortin (POMC), proenkephalin (PENK) and prodynorphin (PDYN) in porcine luteal cells isolated from corpora lutea (CL) collected on days 3-6, 8-10 and 13-16 of the oestrous cycle is reported. PMID: 18277703

Subcellular Location

Secreted.

Protein Families

POMC family

Tissue Specificity

ACTH and MSH are produced by the pituitary gland.

Database Links

KEGG: ssc:396863

STRING: 9823.ENSSSCP00000024582

UniGene: Ssc.14556

Promotions