Recombinant Pig Pro-opiomelanocortin (POMC), partial

Code CSB-YP355615PI
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP355615PI
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP355615PI-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP355615PI
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP355615PI
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
POMC
Uniprot No.
Alternative Names
POMC; Pro-opiomelanocortin; POMC; Corticotropin-lipotropin) [Cleaved into: NPP; Melanotropin gamma; Gamma-MSH); Corticotropin; Adrenocorticotropic hormone; ACTH); Melanocyte-stimulating hormone alpha; Alpha-MSH; Melanotropin alpha); Corticotropin-like intermediary peptide; CLIP); Lipotropin beta; Beta-LPH); Lipotropin gamma; Gamma-LPH); Melanocyte-stimulating hormone beta; Beta-MSH; Melanotropin beta); Beta-endorphin; Met-enkephalin]
Species
Sus scrofa (Pig)
Expression Region
27-106
Target Protein Sequence
WCLE SSQCQDLSTE SNLLACIRAC KPDLSAETPV FPGNGDAQPL TENPRKYVMG HFRWDRFGRR NGSSSGGGGG GGGAGQ
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

This protein is only listed on the website as 500ug,1mg, but is it possible that this protein could provide a smaller SIZE?

A:
Thanks for your inquiry. Recombinant Pig Pro-opiomelanocortin(POMC),partial
CSB-YP355615PI >> Yeast
CSB-EP355615PI >> E.coli
CSB-BP355615PI >> Baculovirus
CSB-MP355615PI >> Mammalian cell
regional representation:27-106aa; Fragment
Tag Information:N-terminal 6xHis-tagged
expressed sequences:

WCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQ


The smallest specification is 50ug

Target Background

Function
Stimulates the adrenal glands to release cortisol.; Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; Increases the pigmentation of skin by increasing melanin production in melanocytes.; Endogenous orexigenic opiate.; Endogenous opiate.
Gene References into Functions
  1. Porcine follicular cells (especially granulosa cells) may produce opioid peptides and that gonadotropins may modulate gene expression of their precursors in these cells. PMID: 17023126
  2. The expression of the genes coding for proopiomelanocortin (POMC), proenkephalin (PENK) and prodynorphin (PDYN) in porcine luteal cells isolated from corpora lutea (CL) collected on days 3-6, 8-10 and 13-16 of the oestrous cycle is reported. PMID: 18277703
Subcellular Location
Secreted.
Protein Families
POMC family
Tissue Specificity
ACTH and MSH are produced by the pituitary gland.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1