Recombinant Pig Sialoadhesin (SIGLEC1), partial

In Stock
Code CSB-EP021293PI
Abbreviation Recombinant Pig SIGLEC1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SIGLEC1
Uniprot No.
Research Area
Immunology
Alternative Names
pSn;Sialic acid-binding Ig-like lectin 1;Siglec-1;p210
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
20-153aa
Target Protein Sequence
SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Sus scrofa (Pig) SIGLEC1 is a bioengineered replica of the native Sialoadhesin. A product of precision research, this protein is meticulously produced for Immunology researchers.

Expressed in E.coli, this partial protein focuses on the 20-153aa region, effectively capturing the most critical aspects of Sialoadhesin's biological role. To facilitate easy purification and detection, the protein carries an N-terminal 10xHis-tag and a C-terminal Myc-tag.

Our Recombinant Sus scrofa (Pig) SIGLEC1 is held to high standards, boasting a purity greater than 90% as determined by SDS-PAGE. This assures that you can trust the quality and consistency of our product in your research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Macrophage-restricted adhesion molecule that mediates sialic-acid dependent binding to lymphocytes, including granulocytes, monocytes, natural killer cells, B-cells and CD8 T-cells. Preferentially binds to alpha-2,3-linked sialic acid. Binds to SPN/CD43 on T-cells. May play a role in hemopoiesis. Acts as an endocytic receptor mediating clathrin dependent endocytosis. In case of porcine reproductive and respiratory syndrome virus (PRRSV), mediates virion attachment and internalization into alveolar macrophages through a clathrin-coated dependent process.
Gene References into Functions
  1. the transcription initiation site for sialoadhesin (Siglec-1), which is a porcine alveolar macrophage-specific gene, was determined by 5' rapid amplification of cDNA end. PMID: 25501171
  2. Fusion protein of sialoadhesin and domains 5-9 of CD163 receptors blocked the respiratory syndrome virus infection. PMID: 24246307
  3. European genotype porcine reproductive and respiratory syndrome virus inhibits porcine alveolar macrophages phagocytosis in vitro, through the interaction with its internalization receptor sialoadhesin. PMID: 22630829
  4. After infection, PRRSV viremia in SIGLEC1(-/-) pigs followed the same course as in SIGLEC1(-/+) and SIGLEC1(+/+) littermates. The absence of SIGLEC1 had no effect on other aspects of PRRSV infection, including disease course and histopathology. PMID: 23785195
  5. Endodomain-deletion mutants of sialoadhesin promoted porcine reproductive and respiratory syndrome virus infection less efficiently. PMID: 23740482
  6. ). These results provided fundamental evidence for CD163 and SN as two functional candidate genes affecting immunity in pigs. PMID: 21786159
  7. effect of antibody binding to pSn on macrophage viability, phagocytosis of microspheres, uptake and processing of soluble antigens, reactive oxygen/nitrogen species production, MHC I and MHC II cell surface expression and cytokine production PMID: 21944562
  8. Porcine sialoadhesin (CD169/Siglec-1) is an endocytic receptor that allows targeted delivery of toxins and antigens to macrophages. PMID: 21359217
  9. The present study demonstrates that the first domain at the N-terminus of Sn mediates porcine reproductive and respiratory syndrome virus (PRRSV) attachment to macrophages. PMID: 19969429
  10. These data show that the sialic acid-binding activity of pSn is essential for PRRSV attachment to pSn and thus identifies the variable, N-terminal domain of Sn as a PRRSV binding domain. PMID: 17567703
  11. Sialoadhesin is confirmed as a PRRSV (porcine reproductive and respiratory syndrome virus)internalization receptor and is shown to interact with CD163 in PRRSV entry. PMID: 19008379
  12. Clear changes in the quantity of sialoadhesin(+) and CD163(+) macrophages in the placentas and organs of embryos/fetuses during gestation. PMID: 19410291

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass membrane protein.
Protein Families
Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family
Database Links

KEGG: ssc:397623

UniGene: Ssc.17338

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*