Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
pSn;Sialic acid-binding Ig-like lectin 1;Siglec-1;p210
Expression Region
20-153aa
Target Protein Sequence
SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Recombinant Sus scrofa (Pig) SIGLEC1 is a bioengineered replica of the native Sialoadhesin. A product of precision research, this protein is meticulously produced for Immunology researchers.
Expressed in E.coli, this partial protein focuses on the 20-153aa region, effectively capturing the most critical aspects of Sialoadhesin's biological role. To facilitate easy purification and detection, the protein carries an N-terminal 10xHis-tag and a C-terminal Myc-tag.
Our Recombinant Sus scrofa (Pig) SIGLEC1 is held to high standards, boasting a purity greater than 90% as determined by SDS-PAGE. This assures that you can trust the quality and consistency of our product in your research.
