Recombinant Plasmodium falciparum Plasmepsin-1

^{In Stock}

Code	CSB-EP340172PLO
Abbreviation	Recombinant Plasmodium falciparum Plasmepsin-1 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

PMI

Uniprot No.

P39898

Research Area

Others

Alternative Names

Plasmepsin-1; EC 3.4.23.38; Aspartic hemoglobinase I; PfAPG

Species

Plasmodium falciparum

Source

E.coli

Expression Region

125-452aa

Target Protein Sequence

AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

41.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The Recombinant Plasmodium falciparum Plasmepsin I is a bioengineered copy of the native Plasmepsin I from Plasmodium falciparum. This protein has been developed using advanced molecular cloning techniques to ensure an exact match to the original.

Our Plasmepsin I protein has been expressed in E.coli, and it encompasses the 125-452aa region of the protein. The protein captures the full length of the mature Plasmepsin I, replicating its original structure and function with high fidelity. It also carries an N-terminal 6xHis-tag for simplified purification and detection.

Our Recombinant Plasmodium falciparum Plasmepsin I is of high quality, boasting a purity greater than 85% as determined by SDS-PAGE. This ensures that you can rely on the integrity and consistency of our product for your research.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

During the asexual blood stage, catalyzes the initial cleavage of native host hemoglobin (Hb) resulting in Hb denaturation; specifically cleaves between Phe-33 and Leu-34 of Hb alpha-chain. Digestion of host Hb is an essential step which provides the parasite with amino acids for protein synthesis, and regulates osmolarity (Probable).

Subcellular Location

Membrane; Single-pass type II membrane protein. Vacuole lumen. Vacuole membrane.

Protein Families

Peptidase A1 family

Promotions