Recombinant Pongo pygmaeus Beta-defensin 126(DEFB126),partial

Code CSB-YP006696EXPe0
Product Type Recombinant Protein
Size US$2959
Uniprot No. A4H244
Relevance Has antibacterial activity.Curated
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Defensin, beta 126
Species Pongo pygmaeus (Bornean orangutan)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Research Area Others
Source Yeast
Gene Names DEFB126
Expression Region 21-63aa
Tag Info N-terminal GST-tagged
Mol. Weight 31.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte. In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation (By similarity).
Subcellular Location Secreted
Protein Families Beta-defensin family

Related Products

DEFB126 Antibodies

DEFB126 Antibodies for Pongo pygmaeus (Bornean orangutan)

DEFB126 Proteins

DEFB126 Proteins for Pongo pygmaeus (Bornean orangutan)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.