Home
Protein
Recombinant Proteins
Recombinant Pongo pygmaeus Beta-defensin 126 (DEFB126), partial

Recombinant Pongo pygmaeus Beta-defensin 126 (DEFB126), partial

^{In Stock}

Code	CSB-YP006696EXPe0
Abbreviation	Recombinant Pongo pygmaeus DEFB126 protein, partial
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

DEFB126

Uniprot No.

A4H244

Research Area

Others

Alternative Names

DEFB126Beta-defensin 126; Defensin; beta 126

Species

Pongo pygmaeus (Bornean orangutan)

Source

Yeast

Expression Region

21-63aa

Target Protein Sequence

SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.9kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression of recombinant Pongo pygmaeus (Bornean orangutan) DEFB126 protein in Yeast cells requires incorporating a DNA fragment encoding the Pongo pygmaeus (Bornean orangutan) DEFB126 protein (21-63aa) into a plasmid vector and transforming this vector into Yeast cells. Positive cells are screened, cultured, and induced to produce the DEFB126 protein. A N-terminal GST tag is attached to the protein. The recombinant Pongo pygmaeus (Bornean orangutan) DEFB126 protein is collected and purified from the cell lysate through affinity purification. It is assessed through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue, with a purity of exceeding 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte. In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation.

Subcellular Location

Secreted.

Protein Families

Beta-defensin family

Promotions