Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
GPX4Phospholipid hydroperoxide glutathione peroxidase; PHGPx; EC 1.11.1.12; Glutathione peroxidase 4; GPx-4; GSHPx-4
Species
ongo pygmaeus (Bornean orangutan)
Expression Region
28-197aa(U73S)
Target Protein Sequence
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Cytoplasmic Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
In the general process of expressing the recombinant ongo pygmaeus (Bornean orangutan) GPX4 protein, a plasmid encoding the ongo pygmaeus (Bornean orangutan) GPX4 protein (28-197aa(U73S)) is constructed first. The plasmid is transferred into e.coli cells, from which cells containing the plasmid are selected and cultured to express the protein. A N-terminal 6xHis-SUMO tag is fused to the protein. The recombinant ongo pygmaeus (Bornean orangutan) GPX4 protein undergoes affinity purification purification and SDS-PAGE analysis. This protein surpasses a purity level of 90%.