Home
Protein
Recombinant Proteins
Recombinant Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE)

Recombinant Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE)

^{In Stock}

Code	CSB-YP838038CMB
Abbreviation	Recombinant Clostridium perfringens nanE protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

nanE

Uniprot No.

Q8XNZ3

Research Area

Others

Species

Clostridium perfringens (strain 13 / Type A)

Source

Yeast

Expression Region

1-221aa

Target Protein Sequence

MLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDILK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.7 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE) is produced using a yeast expression system. The expression construct encodes the full-length nanE protein from Clostridium perfringens, spanning amino acids 1 to 221, and includes a C-terminal 6xHis-tag for purification purposes. The production process involves introducing the expression construct into yeast cells and allowing them to express and synthesize the recombinant nanE protein. The purified recombinant nanE protein exhibits a purity of up to 85%, as determined by SDS-PAGE analysis. On the gel, the nanE protein migrates as a band with an approximate molecular weight of 28 kDa.

nanE mainly catalyzes the conversion of N-acetylmannosamine-6-phosphate (ManNAc-6-P) to N-acetylglucosamine-6-phosphate (GlcNAc-6-P), playing crucial in the biosynthesis of N-acetylneuraminic acid (Neu5Ac), which is an essential component of various cellular structures such as glycoproteins, glycolipids, and polysaccharides.