Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
HINT1; HINTHistidine triad nucleotide-binding protein 1; EC 3.-.-.-; Adenosine 5'-monophosphoramidase; P13.7
Species
Oryctolagus cuniculus (Rabbit)
Expression Region
2-126aa
Target Protein Sequence
ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Rabbit HINT1 contains amino acids 2-126. The expected molecular weight for the HINT1 protein is calculated to be 17.6 kDa. This HINT1 protein is produced using mammalian cell expression system. The N-terminal 10xHis tag and C-terminal Myc tag was fused into the coding gene segment of HINT1, making it easier to detect and purify the HINT1 recombinant protein in the later stages of expression and purification.
The rabbit histidine triad nucleotide-binding protein 1 (HINT1) is a vital player in nucleotide metabolism, contributing to purine nucleotide recycling within cells. Its main functions extend to regulating cellular processes such as signal transduction, apoptosis, and genomic stability. Research on rabbit HINT1 focuses on unraveling its precise roles in nucleotide metabolism and cellular signaling pathways. Additionally, investigations explore the potential implications of HINT1 in various physiological and pathological conditions. Understanding the functions of rabbit HINT1 provides valuable insights into conserved biological processes across species, shedding light on its significance in maintaining cellular homeostasis and its potential as a target for therapeutic interventions.
