Recombinant Rabbit Histidine triad nucleotide-binding protein 1(HINT1)

In Stock

Code CSB-MP301425RB
Product Type Recombinant Protein
Size US$368Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P80912
Lead Time 3-7 business days
Relevance Functions as enzyme, and as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity). Hydrolyzes purine nucleotide phosphoramidates, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Adenosine 5'-monophosphoramidase P13.7
Species Oryctolagus cuniculus (Rabbit)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
Research Area Epigenetics and Nuclear Signaling
Source Mammalian cell
Gene Names HINT1
Protein Names Recommended name: Histidine triad nucleotide-binding protein 1 EC= 3.-.-.- Alternative name(s): Adenosine 5'-monophosphoramidase P13.7
Expression Region 2-126aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 17.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Functions as enzyme, and as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity). Hydrolyzes purine nucleotide phosphoramidates, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide.
Subcellular Location Cytoplasm, Nucleus
Protein Families HINT family
Tissue Specificity Widely expressed.
Database Links

KEGG: ocu:100009302

STRING: 9986.ENSOCUP00000005709

UniGene: Ocu.3078

Related Products

HINT1 Antibodies

HINT1 Antibodies for Human

HINT1 Antibodies for Homo sapiens (Human)

HINT1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

HINT1 Proteins

HINT1 Proteins for Oryctolagus cuniculus (Rabbit)

HINT1 Proteins for Mus musculus (Mouse)

HINT1 Proteins for Homo sapiens (Human)

HINT1 Proteins for Rattus norvegicus (Rat)

HINT1 Proteins for Bos taurus (Bovine)

HINT1 Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

HINT1 cDNA

HINT1 cDNA for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.