Recombinant Rat Insulin-1(Ins1),partial

Code CSB-EP355622RA
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Ins1
Uniprot No. P01322
Research Area Others
Species Rattus norvegicus (Rat)
Source E.coli
Expression Region 25-54aa
Target Protein Sequence FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 19.4 kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

1.CSB-EP355622RA Recombinant Rat Insulin-1 (Ins1), partial
Could you please provide sequence, pricing, availability and tag information for all available sizes?
2.I'm interested in a full-length Recombinant Rat Insulin-1 protein. If you have it please provide us with the detailed information (sequence, pricing, availability and tag information for all available sizes) as well.
3.Could you please confirm any modifications that the protein may have?
Thank you in advance.

A:
Thanks for your inquiry.
Recombinant Rat Insulin-1(Ins1),partial
CSB-EP355622RA >> E.coli
Expression Region: 25-54aa; Partial, provide the Insulin-1 B chain
Tag information:N-terminal 6xHis-SUMO-tagged.
Sequence:
FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Reference: https://www.uniprot.org/uniprot/P01322#ptm_processing
It exists interchain disulfide bond modification.
Below are the details of the risk-free custom service for the full length of Recombinant Rat Insulin-1 protein.
Recombinant Rat Insulin-1(Ins1)
CSB-YP355622RA(A4) >> Yeast
CSB-EP355622RA(A4) >> E.coli
CSB-BP355622RA(A4) >> Baculovirus
CSB-MP355622RA(A4) >> Mammalian cell
Expression Region: 25-110aa; Full length of the mature protein.
Tag information: Tag type will be determined during the manufacturing process.
We can try to express your desired tag first if you have special request for the tag, but as we can't guarantee, if it's failed, we can provide protein with other tag.
Sequence:

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN


Reference: https://www.uniprot.org/uniprot/P01322
If we can successfully express this protein, you could pay the corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you don't need to pay any fees. However you could pay for the gene synthesis and subcloning to purchase the constructed plasmid and strains if you need.
PS: The expression plasmid is not for sale if this project is successful.
 Customer Reviews

Target Data

Function Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Subcellular Location Secreted
Protein Families Insulin family
Database Links

KEGG: rno:24505

STRING: 10116.ENSRNOP00000016052

UniGene: Rn.962

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.