Recombinant Rat Insulin-1(Ins1),partial

Code CSB-EP355622RA
Product Type Recombinant Protein
Size US$2466
Uniprot No. P01322
Relevance Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Research Area Others
Source E.coli
Gene Names Ins1
Protein Names Ins-1
Expression Region 25-54aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 19.4 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Subcellular Location Secreted
Protein Families Insulin family
Database Links

KEGG: rno:24505

STRING: 10116.ENSRNOP00000016052

UniGene: Rn.962

Q&A and Customer Reviews

Q&A
Q:

1.CSB-EP355622RA Recombinant Rat Insulin-1 (Ins1), partial
Could you please provide sequence, pricing, availability and tag information for all available sizes?
2.I'm interested in a full-length Recombinant Rat Insulin-1 protein. If you have it please provide us with the detailed information (sequence, pricing, availability and tag information for all available sizes) as well.
3.Could you please confirm any modifications that the protein may have?
Thank you in advance.

A:
Thanks for your inquiry.
Recombinant Rat Insulin-1(Ins1),partial
CSB-EP355622RA >> E.coli
Expression Region: 25-54aa; Partial, provide the Insulin-1 B chain
Tag information:N-terminal 6xHis-SUMO-tagged.
Sequence:
FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Reference: https://www.uniprot.org/uniprot/P01322#ptm_processing
It exists interchain disulfide bond modification.
Below are the details of the risk-free custom service for the full length of Recombinant Rat Insulin-1 protein.
Recombinant Rat Insulin-1(Ins1)
CSB-YP355622RA(A4) >> Yeast
CSB-EP355622RA(A4) >> E.coli
CSB-BP355622RA(A4) >> Baculovirus
CSB-MP355622RA(A4) >> Mammalian cell
Expression Region: 25-110aa; Full length of the mature protein.
Tag information: Tag type will be determined during the manufacturing process.
We can try to express your desired tag first if you have special request for the tag, but as we can't guarantee, if it's failed, we can provide protein with other tag.
Sequence:

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN


Reference: https://www.uniprot.org/uniprot/P01322
If we can successfully express this protein, you could pay the corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you don't need to pay any fees. However you could pay for the gene synthesis and subcloning to purchase the constructed plasmid and strains if you need.
PS: The expression plasmid is not for sale if this project is successful.
Customer Reviews

Related Products

Ins1 Antibodies

Ins1 Antibodies for Rattus norvegicus (Rat)

Ins1 Proteins

Ins1 Proteins for Rattus norvegicus (Rat)

Ins1 ELISA Kit

Ins1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.