Name: Recombinant Rat Insulin-1 (Ins1), partial
Brand: CUSABIO
SKU: CSB-EP355622RA

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Ins1

Uniprot No.

P01322

Research Area

Others

Alternative Names

Ins1; Ins-1; Insulin-1 [Cleaved into: Insulin-1 B chain; Insulin-1 A chain]

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

25-54aa

Target Protein Sequence

FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.4 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

1.CSB-EP355622RA Recombinant Rat Insulin-1 (Ins1), partial
Could you please provide sequence, pricing, availability and tag information for all available sizes?
2.I'm interested in a full-length Recombinant Rat Insulin-1 protein. If you have it please provide us with the detailed information (sequence, pricing, availability and tag information for all available sizes) as well.
3.Could you please confirm any modifications that the protein may have?
Thank you in advance.

Thanks for your inquiry.
Recombinant Rat Insulin-1(Ins1),partial
CSB-EP355622RA >> E.coli
Expression Region: 25-54aa; Partial, provide the Insulin-1 B chain
Tag information:N-terminal 6xHis-SUMO-tagged.
Sequence:
FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Reference: https://www.uniprot.org/uniprot/P01322#ptm_processing
It exists interchain disulfide bond modification.
Below are the details of the risk-free custom service for the full length of Recombinant Rat Insulin-1 protein.
Recombinant Rat Insulin-1(Ins1)
CSB-YP355622RA(A4) >> Yeast
CSB-EP355622RA(A4) >> E.coli
CSB-BP355622RA(A4) >> Baculovirus
CSB-MP355622RA(A4) >> Mammalian cell
Expression Region: 25-110aa; Full length of the mature protein.
Tag information: Tag type will be determined during the manufacturing process.
We can try to express your desired tag first if you have special request for the tag, but as we can't guarantee, if it's failed, we can provide protein with other tag.
Sequence:

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

Reference: https://www.uniprot.org/uniprot/P01322
If we can successfully express this protein, you could pay the corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you don't need to pay any fees. However you could pay for the gene synthesis and subcloning to purchase the constructed plasmid and strains if you need.
PS: The expression plasmid is not for sale if this project is successful.

Target Background

Function

Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Gene References into Functions

In conclusion, TRPV4 differently regulates insulin mRNA expression in INS-1E cells via ERK1/2 and NO-dependent mechanisms. PMID: 28359774
CART is important for maintaining the beta-cell phenotype. PMID: 28237718
Expression of ghrelin and ghrelin receptor and glucose stimulated insulin secretion (GSIS) of pancreatic islets. PMID: 28410130
glucagon plus insulin increases FGF21 transcription by stimulating ATF4 expression PMID: 28188284
Under insulin stimulation, and in spite of the less activated mTOR function in high altitude rats, low altitude rats had higher glycogen content and reduced levels of gluconeogenic enzymes with a more enhanced insulin signaling, mainly due to higher levels of phosphorylated IRS1. PMID: 28084108
Reduced sortilin levels associate with lower VLDL apo B secretion. Sortilin facilitates VLDL-B100 secretion by insulin sensitive McArdle RH7777 cells. PMID: 27495870
Data show that quercetin acutely stimulates insulin release, inhibits cell proliferation and induces apoptosis of INS-1 beta cells. PMID: 27336168
Insulin deficiency increases the expression of IGF-1 and IGF-1R in renal mesangial cells and the kidney of diabetic rats, which contributes to the development of diabetic nephropathy. PMID: 26775660
Data suggest that rosuvastatin has the potential to increase basal insulin secretion and reduce glucose-induced insulin secretion. PMID: 26986474
These results identify a novel role for Jagn1 in regulating proinsulin biosynthesis. PMID: 26882284
Data suggest glucose-induced insulin secretion is first up-regulated (acute infection), then down-regulated (chronic infection) in beta cells infected with S. aureus; Pla2g4a is up-regulated in acute infection; Pla2g6 is up-regulated in chronic infection. PMID: 26632509
These observations support the hypothesis that glucagon acts via adenylate cyclase to decrease hepatic GSH levels and induce insulin resistance. PMID: 25961284
Gamma conglutin and glibenclamide increased Ins-1 gene expression in diabetic rats. PMID: 24894193
Data suggest neural mechanism of allostatic insulin secretion in male rats fed liquid diet as meals; allostasis leads to postprandial insulin secretion by pancreatic islets suggestive of neural/neurosecretory regulation to prevent hyperglycemia. PMID: 25159330
Maximal upregulation of many unfolded protein response genes in response to mutant proinsulin production required IRE1. PMID: 25011481
Data indicate that, gestational Di-(2-ethylhexyl)phthalate (DEHP) exposure predisposes F1 offspring to glucometabolic dysfunction by down-regulating the expression of critical genes involved in the insulin signalling pathway. PMID: 25232145
analysis of organization of the beta-structure of rat insulin reveals key regions essential for the propagation and cytotoxicity of amyloid fibrils PMID: 24569992
Data suggest that responsiveness of pancreatic beta cells to glucose level resulting in secretion of insulin involves Glp1/Glp1r (glucagon-like peptide-1/glucagon-like peptide-1 receptor) signaling and GLP1/Glp1r agonists act as hypoglycemic agents. PMID: 24425760
Data indicate that miR-183 was decreased and Foxo1 was upregulated during conversion of dental pulp cells (DPCs) to insulin-producing cells. PMID: 24440707
miR-25 and miR-92a are found as direct modulators of insulin expression; overexpression of miR-25 or miR-92a reduced insulin expression;inhibition of miR-25 and miR-92a expression promoted insulin expression and ultimately enhanced glucose-induced insulin secretion PMID: 24084692
B-cell translocation gene 2 (BTG2) is a crucial regulator in GLP-1-induced insulin gene expression and insulin secretion via upregulation of pancreatic duodenal homeobox-1 (PDX-1) in pancreatic beta-cells. PMID: 23703573
investigation of role of microtubules/actin cytoskeleton in insulin-stimulated glucose uptake in skeletal muscle: Data suggest sequence of reorganization of microtubules, actin remodeling, translocation of GLUT4, and glucose uptake. PMID: 22996137
Exogenous and endogenous ghrelin counteracts GLP-1 action to stimulate cAMP signaling and insulin secretion in islet beta-cells PMID: 22750144
adiponectin in the serum from CR animals increases NO* signaling by activating the insulin pathway PMID: 22319612
Insulin entry into muscle involves a saturable process in the vascular endothelium PMID: 22002008
results revealed a novel function for brain insulin in CTA and an additional source of local synthesis, the central and/or basolateral nuclei of the amygdala. PMID: 22119580
Per-Arnt-Sim (PAS) domain-containing protein kinase (PASK) has a role in insulin hypersecretion PMID: 22065581
Estrogen-related receptor gamma (ERRgamma) is a novel transcriptional regulator of phosphatidic acid phosphatase, LIPIN1, and inhibits hepatic insulin signaling PMID: 21911493
NAD(P)H oxidase is an important source of superoxide in pancreatic islets and the activity of NAD(P)H oxidase is involved in the control of insulin secretion by palmitate. PMID: 20857410
Insulin increased plasma membrane GLUT4 and GLUT1 content 30 and 40 min after treatment and CD36 content in plasma membrane fraction. PMID: 21773965
Insulin (Ins) release is altered by anesthetics. PMID: 18165568
insulin stimulates cell proliferation and c-Myc expression in colon cancer cell lines HT29 and Caco-2, intestinal non-cancer cell line IEC-6, and primary fetal rat intestinal cell (FRIC) cultures. PMID: 17993259
the stimulation of glucose uptake in response to insulin or metabolic stress is dependent in cardiomyocytes on the presence of intact microtubules. PMID: 18063688
Insulin down-regulates specific activity of ATP-binding cassette transporter A1 for high density lipoprotein biogenesis through its specific phosphorylation PMID: 21402379
C-peptide may contribute to plaque development and restenosis formation in patients with insulin resistance and early type 2 diabetes mellitus. (C-peptide) PMID: 17068290
AS160 phosphotyrosine-binding domain constructs inhibit insulin-stimulated GLUT4 vesicle fusion with the plasma membrane PMID: 21454690
Data support the hypothesis that brain insulin is required to support optimal baroreflex function and that a decrease in brain insulin contributes to the fall in baroreflex gain during pregnancy. PMID: 21149828
beta2-Syntrophin is a Cdk5 substrate that restrains the motility of insulin secretory granules. PMID: 20886068
Intrauterine growth retardation leads to the functional change of insulin secretion in the newborn. PMID: 20225168
This study identified second messenger systems in neuropeptide Y neurons of arcuate nucleus which regulate neuron activity and physiological processes such as the control of food intake and body weight, under the combined control of insulin and leptin. PMID: 19671839
Leptin and insulin induce mutual resistance for nitric oxide synthase III activation in adipocytes PMID: 19728324
induction of c-myc expression suppresses gene transcription PMID: 11799123
Insulin preincubation effects on rat vessel contractile responses: role of the endothelium cycooxygenase and nitric oxide synthase pathways. PMID: 11824479
mechanisms involved in the insulin-induced acceleration of ET1 contractions; role of the sarcoplasmic reticulum and calcium. PMID: 11824480
pancreatic release of insulin inhibited by ghrelin PMID: 11834435
effects of insulin and the degree of muscle loading on the phosphorylation of Ser(2448), a site in the mammalian target of rapamycin (mTOR) phosphorylated by protein kinase B (PKB) in vitro PMID: 11884412
Glucagon-like peptide-1 analogue LY315902: effect on intestinal motility and release of insulin and somatostatin PMID: 12047915
endogenously released insulin plays an important role in potentiating pancreatic secretion stimulated by exogenous cholecystokinin (CCK) and intraduodenal infusion of casein PMID: 12120208
the signalling pathways and the effects of insulin were compared to those of glutamine and leucine in isolated hepatocytes from normal and streptozotocin-diabetic rats PMID: 12153571
Insulin modulates GLUT4 trafficking at multiple steps, including not only the endocytotic and exocytotic rates, but also the two rate coefficients coupling the three intracellular compartments. PMID: 12450403

Hide All

Subcellular Location

Secreted.

Protein Families

Insulin family

Database Links

KEGG: rno:24505

STRING: 10116.ENSRNOP00000016052

UniGene: Rn.962

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP355622RA
Abbreviation	Recombinant Rat Ins1 protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Insulin-1 (Ins1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage