Thanks for your inquiry.
Recombinant Rat Insulin-1(Ins1),partial
CSB-EP355622RA >> E.coli
Expression Region: 25-54aa; Partial, provide the Insulin-1 B chain
Tag information:N-terminal 6xHis-SUMO-tagged.
Sequence:
FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Reference: https://www.uniprot.org/uniprot/P01322#ptm_processing
It exists interchain disulfide bond modification.
Below are the details of the risk-free custom service for the full length of Recombinant Rat Insulin-1 protein.
Recombinant Rat Insulin-1(Ins1)
CSB-YP355622RA(A4) >> Yeast
CSB-EP355622RA(A4) >> E.coli
CSB-BP355622RA(A4) >> Baculovirus
CSB-MP355622RA(A4) >> Mammalian cell
Expression Region: 25-110aa; Full length of the mature protein.
Tag information: Tag type will be determined during the manufacturing process.
We can try to express your desired tag first if you have special request for the tag, but as we can't guarantee, if it's failed, we can provide protein with other tag.
Sequence:
FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Reference: https://www.uniprot.org/uniprot/P01322
If we can successfully express this protein, you could pay the corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you don't need to pay any fees. However you could pay for the gene synthesis and subcloning to purchase the constructed plasmid and strains if you need.
PS: The expression plasmid is not for sale if this project is successful.