Recombinant Rat Alpha-1-antiproteinase(Serpina1)

Code CSB-YP021053RA
Product Type Recombinant Protein
Size US$2474
Uniprot No. P17475
Relevance Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Alpha-1 protease inhibitorAlpha-1-antiproteinase;Serpin A1
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR
Research Area Immunology
Source Yeast
Gene Names Serpina1
Protein Names Recommended name: Alpha-1-antiproteinase Alternative name(s): Alpha-1-antitrypsin Alpha-1-proteinase inhibitor Serpin A1
Expression Region 25-411aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 45.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibitor of serine proteases. The primary target is elastase, but also has a moderate affinity for plasmin and thrombin.
Subcellular Location Secreted
Protein Families Serpin family
Tissue Specificity Plasma.
Database Links

KEGG: rno:24648

STRING: 10116.ENSRNOP00000012577

UniGene: Rn.1419

Pathway Complement and coagulation cascades

Related Products

Serpina1 Antibodies

Serpina1 Antibodies for Rattus norvegicus (Rat)

Serpina1 Proteins

Serpina1 Proteins for Rattus norvegicus (Rat)

Serpina1 ELISA Kit

Serpina1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.