Recombinant Rat Alpha-synuclein(Snca)

In Stock
Code CSB-EP021912RAe0
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P37377
Lead Time 3-7 business days
Relevance May be involved in the regulation of dopamine release and transport.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
Research Area Others
Source E.coli
Gene Names Snca
Expression Region 1-140aa
Tag Info N-terminal GST-tagged
Mol. Weight 41.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in the regulation of dopamine release and transport.
Subcellular Location Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted
Protein Families Synuclein family
Tissue Specificity Found only in brain (hippocampus, brainstem and cortex). Specifically expressed in neuronal cell bodies and synapses.
Database Links

KEGG: rno:29219

UniGene: Rn.1827

Related Products

Snca Antibodies

Snca Antibodies for Rat

Snca Proteins

Snca Proteins for Rattus norvegicus (Rat)

Snca ELISA Kit

Snca ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.