Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Cd300lf; Clm1CMRF35-like molecule 1; CLM-1; CD300 antigen-like family member F; CD antigen CD300f
Species
Rattus norvegicus (Rat)
Expression Region
19-181aa
Target Protein Sequence
AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our Recombinant Rat CMRF35-like molecule 1 (CLM-1) is a product carefully crafted to enhance your research endeavors. The CD300f protein encoded by the 'Cd300lf' gene is a member of the CD300 antigen-like family, functioning as a crucial part of immune responses. Expressed from Rat species, this protein offers the opportunity to explore different facets of immunological research.
Our protein is obtained from E.coli, and is tailored to cover the extracellular domain with an expression region of 19-181 amino acids, capturing the key functional domains. To enhance its usability, our protein is labeled with a N-terminal 10xHis-SUMO tag and a C-terminal Myc tag, providing ease in purification and detection. With purity greater than 90% as determined by SDS-PAGE, you can be assured of the product's reliability. We offer the Recombinant Rat CD300f protein in two different formats - liquid or lyophilized powder, catering to diverse experimental conditions.
