Recombinant Rat Caprin family member 2(Caprin2),partial

Code CSB-EP2482RA
Product Type Recombinant Protein
Size US$2466
Uniprot No. M0R6B1
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence PQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHAILQLLQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD
Research Area Cell Biology
Source E.coli
Gene Names Caprin2
Protein Names LOC686779
Expression Region 894-1028aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.2 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Caprin2 Antibodies

Caprin2 Antibodies for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.