Recombinant Rat Matrilysin(Mmp7)

In Stock
Code CSB-EP014677RA
Product Type Recombinant Protein
Size US$2466
Uniprot No. P50280
Lead Time 3-7 business days
Relevance Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Matrin;Matrix metalloproteinase-7 ;MMP-7Pump-1 proteaseUterine metalloproteinase
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Research Area Others
Source E.coli
Gene Names Mmp7
Expression Region 98-267aa
Tag Info N-terminal GST-tagged
Mol. Weight 45.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase (By similarity).
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Peptidase M10A family
Database Links

KEGG: rno:25335

STRING: 10116.ENSRNOP00000014041

UniGene: Rn.10282

Pathway Wnt signaling pathway

Related Products

Mmp7 Antibodies

Mmp7 Antibodies for Rattus norvegicus (Rat)

Mmp7 Antibodies for Rat

Mmp7 Proteins

Mmp7 Proteins for Rattus norvegicus (Rat)

Mmp7 ELISA Kit

Mmp7 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.