• Call: 301-363-4651
  • Email: [email protected]
Cusabio Life Science – Your Biology Science Partner
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Peptide
  • Home
  • Products
    Kits
    • ELISA Kits
    • Exosome Isolation Kits
    • ELISA Kits For Food Safety & Drug Residues
    • Plasmid DNA Purification Maxiprep Kit
    • HCP Detection ELISA Kit
    Proteins
    • Active Proteins*
    • Native Proteins
    • Recombinant Proteins
    • Transmembrane Proteins
    Antibodies
    • Recombinant Antibodies
    • Monoclonal Antibodies
    • Polyclonal Antibodies
    • Secondary Antibodies
    • Tag/Control Antibodies
    • Small Molecular Antibodies
    • ChIP Antibodies
    • Antibody Pairs
    • Custom Antibodies
    • Modified Histone Antibodies
    • Biosimilar Antibodies
    Biochemical Reagents
    • Cell Electrofusion Buffer
    Stable Cell Line Clone Peptide
    • Cosmetic Peptide
    • Amino Acids and Derivatives
    Small Molecule
    • Food Safety Small Molecular Antigens
    • Other Small Molecular Antigens

    Solutions
    • mRNA Vaccine Research Solutions
    • ADC Development Solutions
    • CAR-T Therapy Development Solutions
    Hot Categories
    • IS Series Cytokine Detection ELISA Kit*
    • Mini Sample ELISA kit*
    • Notch Receptors and Ligands
    • Claudin (CLDN) Family Proteins
    • Rare Species Antibodies
    • Anti-CAR Linker Antibody
    • Anti-payload Antibodies
    • Immunohistochemistry (IHC) Antibodies
    • Flow Cytometry Antibodies
    • Recombinant DT3C protein
    • Chemokine Receptors
    • G protein-Coupled Receptor
    • Recombinant Antibodies for Drug Discovery
    • Recombinant Proteins for ADCs
    • New Products Launch
  • CRO Service
    Quote for CRO Service Specialized CRO Services
    • Stable Cell Line Developmentm Service
    • Custom Peptide Synthesis
    • SPR Detection Service
    Protein Expression Services
    • Transmembrane Protein Expression Service*
    • E.coli Expression System
    • Yeast Expression System
    • In vitro E.coli Expression System
    • Insect Baculovirus Expression System
    • Mammalian Cell Expression System
    Oligo Synthesis Service Gene Synthesis Service
    Therapeutic Antibody Discovery Service*
    • Mouse hybridoma screening & sequencing
    • Single B Cell Antibody Discovery*
    • VHH library screening
    Custom Antibody Services
    • HTP Recombinant Antibody Production
    • Recombinant Ab Production
    • Monoclonal Ab Production
    • Polyclonal Ab Production
    • Modified Ab Production
    • Anti-idiotype Antibody Production*
      • Home
      • Protein
      • Recombinant Proteins
      • Recombinant Rat Tryptase (Tpsab1)

      Recombinant Rat Tryptase (Tpsab1)

      In Stock
      Code CSB-EP024127RA
      Abbreviation Recombinant Rat Tpsab1 protein
      MSDS
      MSDS Datasheet
      Size US$306
      Order now
      Image
      • SDS-PAGE- Recombinant protein Rat Tpsab1

        (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

      Have Questions? Leave a Message or Start an on-line Chat
      • Product Details
      • Related Products
      • Customer Reviews and Q&A
      • Target Background

      Product Details

      Purity
      Greater than 90% as determined by SDS-PAGE.
      Target Names
      Tpsab1
      Uniprot No.
      P27435
      Research Area
      Immunology
      Alternative Names
      Tpsab1; Mcp7; Mcpt7; Tpsb1; Tryptase; EC 3.4.21.59; Mast cell protease 7; rMCP-7; Tryptase alpha/beta-1; Tryptase; skin
      Species
      Rattus norvegicus (Rat)
      Source
      E.coli
      Expression Region
      29-273aa
      Target Protein Sequence
      IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYVPKYF
      Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
      If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
      Mol. Weight
      47.4kDa
      Protein Length
      Full Length of Mature Protein
      Tag Info
      N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
      Form
      Liquid or Lyophilized powder
      Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
      Buffer
      If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
      Note: If you have any special requirement for the glycerol content, please remark when you place the order.
      If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
      Reconstitution
      We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
      Troubleshooting and FAQs
      Protein FAQs
      Storage Condition
      Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
      Shelf Life
      The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
      Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
      Lead Time
      3-7 business days
      Notes
      Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
      Datasheet & COA
      Please contact us to get it.

      Related Products

      Tpsab1 Antibodies

      • Tpsab1 Antibody ( ELISA, WB (ensure identification of antigen) ) ( CSB-PA024127ZA01RA )

      Tpsab1 Proteins

      • Recombinant Rat Tryptase (Tpsab1) ( Yeast-CSB-YP024127RA Baculovirus-CSB-BP024127RA Mammalian cell-CSB-MP024127RA In Vivo Biotinylation in E.coli-CSB-EP024127RA-B )

      Tpsab1 ELISA kits

      • Rat Mast Cell Tryptase,MCT ELISA Kit ( CSB-E13627r )

      Customer Reviews and Q&A

      ■ Customer Reviews

      There are currently no reviews for this product.

      Submit a Review here

      Target Background

      Function
      Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity.
      Subcellular Location
      Secreted. Note=Released from the secretory granules upon mast cell activation.
      Protein Families
      Peptidase S1 family, Tryptase subfamily
      Tissue Specificity
      Mast cells.
      Database Links

      KEGG: rno:54271

      STRING: 10116.ENSRNOP00000025095

      UniGene: Rn.10699

      Promotions
      Reward For Reviews
      Free antibody trial
      Contact Us

        Email: [email protected]
        Distributors Worldwide

      Service

      Phage Display Service

      Antibody Service

      • −  Polyclonal Antibody Production
      • −  Monoclonal Antibody Production
      • −  Custom Recombinant Antibody Production
      • −  Modification-specific Antibody Production

      Protein Service

      • −  E.coli Expression Service
      • −  Yeast Expression Service
      • −  In vitro E.coli Expression System
      • −  Insect baculovirus expression system
      • −  Mammalian Cell Expression System

      Gene Synthesis Service

      Oligo Synthesis Service

      Related Articles
      CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
      CUSABIO guaranteed quality
    icon of phone
    Call us
    301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
    icon of email
    Email
    [email protected]
    icon of address
    Address
    7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
    icon of social media
    Join us with

    Subscribe newsletter

    Leave a message

    * To protect against spam, please pass the CAPTCHA test below.
    CAPTCHA verification
    © 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
    Privacy Policy
    Message
    • *
    • *
    • Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.

    • *
    • *
    • CAPTCHA verification

      Please enter the characters shown. Click the image to refresh if unclear.

    •  

    ×CloseMessage

    • *
    • *
    • *
    •  
    Place an order now

    I. Product details

    *
    *
    *
    *

    II. Contact details

    *
    *

    III. Ship To

    *
    *
    *
    *
    *
    *
    *

    IV. Bill To

    *
    *
    *
    *
    *
    *
    *
    *