Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Dio3

Uniprot No.

P49897

Research Area

Others

Alternative Names

Dio3; Itdi3; Txdi3; Thyroxine 5-deiodinase; EC 1.21.99.3; 5DIII; DIOIII; Type 3 DI; Type III iodothyronine deiodinase

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

63-304aa(170:U→missing)

Target Protein Sequence

DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

31.5kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Enhance your endocrinology studies with our premium Recombinant Rat Dio3. This protein, also known as Thyroxine 5-deiodinase, plays a pivotal role in the conversion of thyroid hormone, impacting various physiological processes. By employing this protein in your research, you can delve deeper into thyroid hormone regulation and its associated disorders.

This particular version of Dio3, engineered in E.coli, showcases the extracellular domain with an expression region ranging from the 63rd to the 304th amino acid. Due to its close simulation of native protein conditions, this construct can provide more accurate and relevant results. A modification to note in the sequence is the missing amino acid at the 170th position (U→missing). To ensure smooth purification and detection, we have incorporated a N-terminal 6xHis-tag. Rest assured, this protein comes with a purity greater than 90% as established by SDS-PAGE, ensuring high performance in your experimental applications. Choose from a liquid or lyophilized powder form, according to your research needs. Experience the precision and quality of our Recombinant Rat Dio3 in your research journey.

Target Background

Function

Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.

Gene References into Functions

findings suggest that translational repression of Dio3 is an important determinant of the reduced D3 protein expression following liver damage PMID: 23586759
ischemia/hypoxia induces an Hsp40-mediated translocation of Dio3 to the nucleus, facilitating thyroid hormone inactivation proximal to the thyroid hormone receptors PMID: 22723689
Data suggest that genetic background and sex modify vulnerability to prenatal alcohol via brain region-specific expression of Dio3. PMID: 21429942
we show marked expression of D3 by granulocytes and macrophages in spinal cord inflammatory lesions of EAE rats. We further confirm induction of D3 expression in vitro in monocytes that were activated toward proinflammatory or immunomodulatory phenotypes PMID: 19916870
Induction of D3 activity begins immediately after implantation and increases markedly over next 72 hours. In spontaneously cycling female rats, both D2 and D3 were observed to be 3- to 8-fold higher in proestrus, compared with diestrus. PMID: 12959985
genomic imprinting and gene expression at the Dlk1/Dio3 imprinted domain may play a role in the regulation of adipocyte proliferation and differentiation PMID: 17510246
Acute decrease in serum T(4) and T(3) after myocardial infarction is due to increased thyroid hormone catabolism from ectopic D3 expression in the heart. PMID: 17628010
a mechanism of metabolic regulation during hypoxic-ischemic injury in which HIF-1 reduces local thyroid hormone signaling through induction of D3. PMID: 18259611
Dio3 is important in the modulation of thyroid hormone levels in the regenerating liver, in which decrease in cellular T3 permits an increase in proliferation. PMID: 18787028

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein.

Protein Families

Iodothyronine deiodinase family

Tissue Specificity

Neonatal skin, placenta, skeletal muscle and cerebral cortex.

Database Links

KEGG: rno:29475

UniGene: Rn.11237

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP344617RA
MSDS	MSDS
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Thyroxine 5-deiodinase (Dio3), partial (170:U→missing)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage