Recombinant Rat cGMP-inhibited 3',5'-cyclic phosphodiesterase A (Pde3a), partial

Code CSB-YP714035RA
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP714035RA
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP714035RA-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP714035RA
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP714035RA
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Pde3acGMP-inhibited 3',5'-cyclic phosphodiesterase A; EC 3.1.4.17; Cyclic GMP-inhibited phosphodiesterase A; CGI-PDE A
Species
Rattus norvegicus (Rat)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We have an inquiry for your product;#CSB-MP714035RA Recombinant Rat cGMP-inhibited 3',5'-cyclic phosphodiesterase A(Pde3a) ,partial, Mammalian cell.
​​We have heard from you previously that " The Cat No begins of CSB-MP***** means that the expression system of this protein is Mammalian Cell. All of our recombinant proteins which are made from Mammalian cells do not use virus vector".
Has it been not changed?
I would like to know​ ​the gene introduction method to introduce the gene into the mammalian cells.
​Do you use viral system or not?​

A:
Very nice to receive your inquiry. The information is listed as follow:
Recombinant Rat cGMP-inhibited 3',5'-cyclic phosphodiesterase A(Pde3a),partial
CSB-YP714035RA >> Yeast
CSB-EP714035RA >> E.coli
CSB-BP714035RA >> Baculovirus
CSB-MP714035RA >> Mammalian cell
Express Region:671-1095aa ;partial,contain PDEase Domain
Tag information:Tag type will be determined during the manufacturing process.
The expected tag for each epression system is listed as follows: EP,BP,MP:N-terminal 10xHis-tagged and C-terminal Myc-tagged;YP:N-terminal 6xHis-tagged
Sequence:

ILAPEPLVMDNLDSIMDQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFEDMGLFEAFKIPVREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLPSVIGDHGSASDSDSDSGFTHGHMGYVFSKAYHVPDDKYGCLSGNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLVNLDHVEFKHFRFLVIEAILATDLKKHFDFVAKFNAKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKDLHLRWTEGIASEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCHSYDSAGLMPGKWVDDSDDSGDTDDPEEEEEEAETPHEEETCENSEAPRKKSFKRRRIYCQITQHLLQNHMMWKKVIEEEQC


If you are interested in other expresion region, please feel free to contact us.
1)CSB-MP**** means that the expression system of this protein is Mammalian Cell. All of our recombinant proteins which are made from Mammalian cells do not use virus vector.
2 We use the transfection kit for transfecting and don't use any virus system.

Target Background

Function
Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
Gene References into Functions
  1. PDE3A is a low-affinity and high-velocity enzyme for hydrolysis of cUMP in cardiac myocytes. PMID: 27975297
  2. Observations suggest that NO modulates PDE3A gene expression via mechanisms dependent upon cGMP synthesis and gene transcription. PMID: 21224496
  3. Increased phosphodiesterase 3A/4B expression after angioplasty and the effect on VASP phosphorylation. PMID: 18571642
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Cyclic nucleotide phosphodiesterase family, PDE3 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1