Recombinant Reston ebolavirus Matrix protein VP40 (VP40)

Code CSB-EP810348RCJ
Abbreviation Recombinant Reston ebolavirus VP40 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP810348RCJ could indicate that this peptide derived from E.coli-expressed Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus) VP40.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP810348RCJ could indicate that this peptide derived from E.coli-expressed Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus) VP40.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VP40
Uniprot No.
Research Area
others
Alternative Names
VP40Matrix protein VP40; Membrane-associated protein VP40
Species
Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus)
Source
E.coli
Expression Region
1-331aa
Target Protein Sequence
MRRGVLPTAPPAYNDIAYPMSILPTRPSVIVNETKSDVLAVPGADVPSNSMRPVADDNIDHSSHTPSGVASAFILEATVNVISGTKVLMKQIPIWLPLGVADQKIYSFDSTTAAIMLASYTVTHFGKISNPLVRVNRLGPGIPDHPLRLLRLGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDETPAGAVNALRPGLSLHPKLRPILLPGKTGKKGHASDLTSPDKIQTIMNAIPDLKIVPIDPTKNIVGIEVPELLVQRLTGKKPQPKNGQPIIPVLLPKYVGLDPISPGDLTMVITQDCDSCHSPASHPYHMDKQNSYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis).
Gene References into Functions
  1. Hexameric model of VP40 using X-ray and electron microscopy was presented. PMID: 15908231
Subcellular Location
Virion membrane; Peripheral membrane protein. Host late endosome membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein; Cytoplasmic side. Host endomembrane system; Peripheral membrane protein.
Protein Families
Filoviridae matrix protein VP40 family
Database Links

KEGG: vg:955192

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*