Home
Protein
Recombinant Proteins
Recombinant Rickettsia japonica 17 kDa surface antigen (omp)

Recombinant Rickettsia japonica 17 kDa surface antigen (omp)

^{In Stock}

Code	CSB-EP706583RMU
Abbreviation	Recombinant Rickettsia japonica omp protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

omp

Uniprot No.

Q52764

Research Area

Microbiology

Alternative Names

omp; RJP_094417 kDa surface antigen

Species

Rickettsia japonica (strain ATCC VR-1363 / YH)

Source

E.coli

Expression Region

20-159aa

Target Protein Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

30.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Dive deeper into your microbiological studies with our Recombinant Rickettsia japonica omp. This product encodes the 17 kDa surface antigen from the YH strain of Rickettsia japonica, produced meticulously in an E.coli system. From the 20th to the 159th amino acid, this protein parallels the complete length of the mature antigen, ensuring precise observations and results in your research.

This Rickettsia japonica omp protein is crafted with a N-terminal 6xHis-SUMO tag for uncomplicated purification and identification processes. With an impressive purity level of over 90%, as confirmed by SDS-PAGE, the integrity and quality of this product are assured. You have the flexibility to choose between a liquid or lyophilized powder form according to your laboratory requirements. Advance your research with our Recombinant Rickettsia japonica omp, designed for precision and reliability.