Recombinant Rickettsia japonica 17 kDa surface antigen(omp)


In Stock
Code CSB-EP706583RMU
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q52764
Lead Time 3-7 business days
Abbreviation omp
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rickettsia japonica (strain ATCC VR-1363 / YH)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
Research Area Microbiology
Source E.coli
Gene Names omp
Protein Names Recommended name: 17 kDa surface antigen
Expression Region 20-159aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 30.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell outer membrane, Lipid-anchor
Protein Families Rickettsiale 17 kDa surface antigen family
Database Links

KEGG: rja:RJP_0944

Related Products

omp Antibodies

omp Antibodies for Rickettsia japonica (strain ATCC VR-1363 / YH)

omp Proteins

omp Proteins for Rickettsia japonica (strain ATCC VR-1363 / YH)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.