Recombinant Salmo salar Prolactin (prl)

In Stock
Code CSB-EP018724SWI
Abbreviation Recombinant Salmo salar prl protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
PRL
Species
Salmo salar (Atlantic salmon)
Source
E.coli
Expression Region
24-210aa
Target Protein Sequence
IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Salmo salar Prolactin is produced in E.coli and contains the complete mature protein sequence, spanning amino acids 24 to 210. The product includes a C-terminal 6xHis-tag that simplifies purification and detection processes. SDS-PAGE analysis confirms purity levels above 90%, making it well-suited for research applications that demand high-quality protein standards and consistent results.

Prolactin appears to be a hormone with well-established roles in fish growth and development, particularly in osmoregulation and reproductive functions. Research on endocrine mechanisms and physiological adaptations in aquatic species often relies on this hormone to understand how environmental factors may influence hormone-driven processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Prolactin is a complex four-helix bundle hormone requiring specific disulfide bonds and tertiary structure for receptor binding and bioactivity. E. coli lacks eukaryotic chaperones and oxidative folding machinery, making correct disulfide bond formation unlikely. The C-terminal His tag may not directly interfere with folding, but it cannot compensate for fundamental limitations. Without experimental validation (e.g., receptor binding or cell-based activity assays), this protein is highly likely to be misfolded and inactive.

1. Comparative Endocrinology Studies

This application requires confirmed bioactivity. If misfolded, competitive binding assays will yield inaccurate cross-species affinity data. First, validate receptor binding using salmon prolactin receptors (e.g., via SPR). If properly folded, this recombinant Salmo salar prolactin could serve as a reference standard when examining prolactin structure and function across various fish species. Without activity, evolutionary comparisons are invalid.

2. Antibody Development and Validation

This recombinant prolactin is suitable for generating antibodies against linear epitopes. The His tag facilitates purification and immobilization for screening. However, antibodies may not recognize conformational epitopes of native prolactin. Validate against pituitary-derived salmon prolactin for physiological relevance.

3. Protein-Protein Interaction Studies

His-tag enables pull-down assays, but misfolding may cause non-physiological interactions (e.g., false positives with non-native partners). Validate any interactions using co-immunoprecipitation with native prolactin from salmon tissues.

4. Biochemical Characterization and Stability Studies

Applicable for basic biophysical analysis (e.g., CD spectroscopy for helical content, DLS for aggregation). However, data reflect E. coli-derived protein properties, not native prolactin. Do not extrapolate stability results to physiological contexts.

Final Recommendation & Action Plan

Validate bioactivity before functional use. Perform receptor binding assays (e.g., with salmon prolactin receptor-expressing cells) or cell proliferation tests (e.g., Nb2 rat lymphoma bioassay). If active, proceed with comparative/interaction studies; if inactive, limit to antibody production with validation against native prolactin. For reliable results, express prolactin in eukaryotic systems (e.g., yeast/mammalian cells) to ensure proper folding. Always include native prolactin controls to confirm biological relevance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted.
Protein Families
Somatotropin/prolactin family
Database Links

KEGG: sasa:100136580

UniGene: Ssa.907

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*