Recombinant Sheep Bone morphogenetic protein 15 (BMP15)

In Stock
Code CSB-EP002735SH
Abbreviation Recombinant Sheep BMP15 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
BMP15
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(BMP-15)(Growth/differentiation factor 9B)(GDF-9B)
Species
Ovis aries (Sheep)
Source
E.coli
Expression Region
269-393aa
Target Protein Sequence
QAGSIASEVPGPSREHDGPESNQCSLHPFQVSFQQLGWDHWIIAPHLYTPNYCKGVCPRVLHYGLNSPNHAIIQNLVSELVDQNVPQPSCVPYKYVPISILLIEANGSILYKEYEGMIAQSCTCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
Gene References into Functions
  1. activin can explain that the effects of BMP15 mutations differ when present in different genetic backgrounds PMID: 28069901
  2. BMP15 mutation is associated with prolificacy and female sterility. PMID: 28506298
  3. Studied polymorphism of BMP15 gene exon 1 using single strand conformational polymorphism (SSCP) and direct DNA sequencing methods in 170 Mehraban and Lori sheep ewes. PMID: 27565869
  4. study concluded that growth differentiation factor 9 and bone morphogenetic protein 15 follow stage-specific pattern of expression during the in vivo development of ovarian follicles in sheep, and in vitro culture altered these changes PMID: 26474685
  5. two novel mutations in the BMP15 gene are associated with increased litter size and ovulation rate PMID: 23637641
  6. Combined effect analyses indicated an extremely significant interaction between the random combinations of BMPR-IB, BMP-15 and FSHR genes on litter size. PMID: 25993301
  7. A higher number of oocytes proven to be competent for in vitro development and embryo survival after transfer are recovered from R+ ewes, despite the lower mean size of their follicles at puncture. PMID: 23438026
  8. The Lleyn breed was the most likely source of the BMP15 FecX(G) and GDF9 FecG(H) mutations in Belclare and Cambridge sheep, and the BMP15 FecX(B) mutation came from the High Fertility line developed from prolific ewes in commercial flocks in Ireland. PMID: 23301039
  9. Studies indicate that in BMP15-Knockout sheep, oocytes die as follicles start to grow. PMID: 23417416
  10. DNA polymorphism studies of BMP 15 gene in Corriedale and local Kashmir valley sheep (Ovis aries). PMID: 22425967
  11. A mutation in the bone morphogenetic protein 15 gene (FecXR allele) causes increased prolificity in heterozygous and sterility in homozygous ewes. PMID: 21622876
  12. It is concluded that the mutation in the BMP15 gene in I+ ewes leads to an earlier acquisition of LH responsiveness by granulosa cells in a greater proportion of follicles and this accounts for the small higher ovulation-rate in these animals. PMID: 19535491
  13. Data suggest an interaction between BMP15 levels and nutritional signals in the follicle to control ovulation rate; studies involved heterozygous Inverdale ewes. PMID: 21871206
  14. investigation of regulation of gene expression of BMP15 in ovulation: Higher ovulation rate in BB sheep (homozygous for mutation in BMPR1B) is due, at least in part, to low oocyte-derived BMP15 mRNA levels. PMID: 21474605
  15. 11-point mutations of BMP1B, BMP15, and GDF9 genes of 97 Bonpala ewes were genotyped. PMID: 21774623
  16. A significant association was found between BMP15 gene HinfI polymorphism and litter size in fat-tailed sheep. The heterozygous genotype showed higher litter size. PMID: 21327517
  17. These heterozygous genotypes resulted in higher ovulation rates, illustrating that one copy of each of the BMP15 and GDF9 mutations had equivalent effects on the ovulation rate. PMID: 19144040
  18. BMP15 has an essential role in ovarian folliculogenesis and the control of ovulation rate in sheep. PMID: 17038554
  19. Small Tailed Han ewes carrying mutations in both BMPR-IB and BMP-15 genes had greater litter size than those with either mutation alone. PMID: 17040942
  20. sequence of the complete coding region of BMP15 gene and determination of the patterns of expression of mRNAs encoding BMP15 PMID: 17715428
  21. in BMP15, this new mutation is associated with increased prolificacy and sterility in heterozygous and homozygous ewes respectively PMID: 18355397
  22. Expression patterns of 4 maternal effect genes (ZAR1, MATER, GDF9, and BMP15) were determined in ovine oocytes and in vitro-produced preimplantation embryos [ZAR1]. PMID: 19007555

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Database Links

KEGG: oas:100141303

UniGene: Oar.16287

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*