Recombinant Sheep Somatoliberin(GHRH)

Code CSB-EP009412SH
Product Type Recombinant Protein
Size US$2466
Uniprot No. P07217
Relevance GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Growth hormone-releasing factor ;GRFGrowth hormone-releasing hormone ;GHRH
Species Ovis aries (Sheep)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
Research Area Others
Source E.coli
Gene Names GHRH
Protein Names Recommended name: Somatoliberin Alternative name(s): Growth hormone-releasing factor Short name= GRF Growth hormone-releasing hormone Short name= GHRH
Expression Region 1-44aa
Tag Info N-terminal GST-tagged
Mol. Weight 32.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Subcellular Location Secreted
Protein Families Glucagon family
Database Links

UniGene: Oar.14370

Related Products

GHRH Antibodies

GHRH Antibodies for Ovis aries (Sheep)

GHRH Antibodies for Sheep

GHRH Proteins

GHRH Proteins for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.