Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB)

In Stock
Code CSB-YP357862SKY
Abbreviation Recombinant Staphylococcus aureus hlgB protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
hlgB
Uniprot No.
Research Area
others
Alternative Names
hlgB; SA2209; Gamma-hemolysin component B; H-gamma-1; H-gamma-I
Species
Staphylococcus aureus (strain N315)
Source
Yeast
Expression Region
26-325aa
Target Protein Sequence
AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB) is expressed in yeast and covers the full length of the mature protein from amino acids 26 to 325. The protein carries an N-terminal 6xHis-tag for purification and detection purposes. SDS-PAGE analysis indicates a purity greater than 90%, which appears to provide high-quality preparation suitable for research applications.

Gamma-hemolysin component B forms part of the two-component gamma-hemolysin toxin that Staphylococcus aureus produces. This protein likely plays a critical role in creating pores within host cell membranes, thereby contributing to the bacterium's pathogenic behavior. Understanding hlgB's structure and function may prove essential for bacterial virulence studies and could inform the development of therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant hlgB protein are unknown and cannot be assumed. Gamma-hemolysin component B (hlgB) is a bacterial pore-forming toxin whose function is strictly dependent on its ability to correctly oligomerize with other components (hlgA and hlgC) to form a functional pore complex. While expression in a yeast system (eukaryotic) may support disulfide bond formation, the protein originates from a prokaryotic pathogen (S. aureus), and its correct folding and assembly into a heptameric pore are highly complex. The presence of an N-terminal 6xHis tag could potentially interfere with the N-terminal region, which might be critical for interactions with other components or for membrane insertion. The >90% purity indicates a clean preparation but does not confirm correct tertiary structure or oligomerization capability. Therefore, applications that depend on specific biological interactions or pore-forming activity are speculative without validation.

1. Protein-Protein Interaction Studies

The His-tagged recombinant hlgB can be immobilized for pull-down or co-IP experiments. However, the utility for studying interactions with hlgA or hlgC is entirely contingent on the protein being correctly folded and capable of adopting a conformation that allows for specific binding. The N-terminal tag may sterically hinder the interaction interfaces. If the hlgB protein is misfolded, it will not oligomerize correctly, and any observed binding may be non-specific. This application should not be pursued without first confirming the protein's activity in a functional oligomerization or hemolysis assay.

2. Antibody Development and Characterization

This recombinant hlgB is suitable for use as an immunogen to generate antibodies. The high purity minimizes cross-reactivity issues during immunization. However, it is important to note that antibodies generated will be primarily against linear epitopes of this recombinant form. Their ability to recognize the native, oligomeric pore complex on the surface of target cells or to neutralize the toxin's hemolytic activity is not guaranteed and must be empirically validated. The protein is reliable for developing antibodies for detection assays (e.g., Western blot).

3. Biochemical Characterization and Stability Studies

This purified recombinant hlgB protein is well-suited for detailed biochemical and biophysical characterization. Studies on its thermal stability, pH tolerance, and protease sensitivity can be performed. This application is valid as it focuses on the intrinsic physical properties of the recombinant hlgB protein and does not require native bioactivity.

4. Competitive Binding Assays

This application is not feasible without prior validation of bioactivity. The entire premise of screening for "inhibitors" or studying "receptor interactions" presupposes that the hlgB protein is correctly folded and functional. If the recombinant hlgB protein is inactive, any binding data from competitive assays would be meaningless. This application should be considered only after the protein's functional interaction with its partners (hlgA/hlgC) and/or its ability to bind to target membranes has been demonstrated.

Final Recommendation & Action Plan

The immediate and critical priority is to experimentally validate the bioactivity of this recombinant hlgB protein before investing in functional studies. The essential first step is to perform a functional assay, such as a hemolysis assay using red blood cells in the presence of the other gamma-hemolysin components (hlgA and hlgC) to test for synergistic pore-forming activity. Alternatively, an oligomerization assay (e.g., native PAGE or size-exclusion chromatography with multi-angle light scattering) could confirm its ability to form complexes. If bioactivity is confirmed, the protein becomes valuable for interaction studies (Application 1) and competitive binding assays (Application 4). If inactive, its use should be restricted to antibody development (Application 2) and biochemical characterization (Application 3). The high purity is a good starting point, but functionality must be proven before any mechanistic studies are undertaken.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity.
Protein Families
Aerolysin family
Database Links

KEGG: sau:SA2209

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*