Recombinant Staphylococcus aureus Gamma-hemolysin component B(hlgB)

Code CSB-EP357862SKYa2
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0A075
Relevance Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias H-gamma-1 H-gamma-I
Species Staphylococcus aureus (strain N315)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Research Area Microbiology
Source E.coli
Gene Names hlgB
Expression Region 26-325aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 50.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity (By similarity).
Protein Families Aerolysin family
Database Links

KEGG: sau:SA2209

Related Products

hlgB Antibodies

hlgB Antibodies for Staphylococcus aureus (strain N315)

hlgB Proteins

hlgB Proteins for Staphylococcus aureus (strain N315)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.