Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

hlgB

Uniprot No.

P0A075

Research Area

others

Alternative Names

hlgB; SA2209; Gamma-hemolysin component B; H-gamma-1; H-gamma-I

Species

Staphylococcus aureus (strain N315)

Source

E.coli

Expression Region

26-325aa

Target Protein Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

38.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Staphylococcus aureus (strain N315) hlgB contains amino acids 26-325. This hlgB protein is expected to have a theoretical molecular weight of 38.1 kDa. This hlgB protein is produced using e.coli expression system. The N-terminal 6xHis tag was smoothly integrated into the coding gene of hlgB, which enables a simple process of detecting and purifying the hlgB recombinant protein in the following steps.

The Staphylococcus aureus gamma-hemolysin component B (hlgB) is a subunit of the bicomponent gamma-hemolysin toxin, which also includes HlgA. Gamma-hemolysin is known for its hemolytic activity, which involves the lysis of red blood cells. The hlgB in conjunction with HlgA, forms pores in the target cell membrane, leading to cell lysis. This cytolytic activity is implicated in the pathogenicity of S. aureus, contributing to tissue damage and evasion of the host immune response. Understanding the molecular mechanisms and regulation of gamma-hemolysin, including the role of HlgB, is crucial for developing strategies to combat S. aureus infections. Additionally, the study of this toxin provides insights into the intricate interactions between bacterial pathogens and host cells.

Target Background

Function

Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity.

Protein Families

Aerolysin family

Database Links

KEGG: sau:SA2209

Code	CSB-EP357862SKY
Abbreviation	Recombinant Staphylococcus aureus hlgB protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357862SKY could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) hlgB. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357862SKY could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) hlgB.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage