Home
Protein
Recombinant Proteins
Recombinant Staphylococcus aureus 30S ribosomal protein S5 (rpsE)

Recombinant Staphylococcus aureus 30S ribosomal protein S5 (rpsE)

^{In Stock}

Code	CSB-EP409092FLG
Abbreviation	Recombinant Staphylococcus aureus rpsE protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

rpsE

Uniprot No.

A6QJ75

Research Area

Others

Species

Staphylococcus aureus (strain Newman)

Source

E.coli

Expression Region

1-163aa

Target Protein Sequence

MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.8 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Achieving the recombinant Staphylococcus aureus (strain Newman) rpsE protein production entails controlling the expression of the desired gene in e.coli cells. The sequence (1-163aa) of foreign DNA is integrated into an expression vector and then transferred to e.coli cells. Selected positive cells are cultured to induce the expression of the desired protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. The recombinant Staphylococcus aureus (strain Newman) rpsE protein is purified through affinity purification, exhibiting a purity greater than 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

With S4 and S12 plays an important role in translational accuracy.; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body.

Protein Families

Universal ribosomal protein uS5 family

Database Links

KEGG: sae:NWMN_2135

Promotions