Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

chp

Uniprot No.

Q6GFB3

Research Area

others

Alternative Names

chp; SAR2036Chemotaxis inhibitory protein; CHIPS

Species

Staphylococcus aureus (strain MRSA252)

Source

Yeast

Expression Region

29-149aa

Target Protein Sequence

FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

16.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Investigate host-pathogen interactions with our Recombinant Staphylococcus aureus chp, a vital player in bacterial evasion of host immune responses. This product, known as the Chemotaxis inhibitory protein (CHIPS), inhibits neutrophil chemotaxis, a key defense mechanism, thereby giving the bacterium an edge during infection. Derived from the notorious methicillin-resistant Staphylococcus aureus strain MRSA252, this protein adds significant value to your research in microbial pathogenesis.

This mature form of the protein consists of amino acids 29-149, replicating the functionally active form of the protein present in the bacterium. The expression is conducted in a yeast system, ensuring proper folding and post-translational modifications. Equipped with an N-terminal 6xHis-tag, this protein facilitates straightforward purification and application in various assays. The Recombinant Staphylococcus aureus chp passes stringent purity checks, with its purity greater than 90% as determined by SDS-PAGE. You can choose from a liquid or lyophilized powder form, as per your research requirements. Expand the horizons of your immunological research with the application of this vital bacterial protein.

Target Background

Function

Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP). Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium.

Subcellular Location

Secreted.

Protein Families

CHIPS/FLIPr family

Database Links

KEGG: sar:SAR2036

Code	CSB-YP746696SKV
Abbreviation	Recombinant Staphylococcus aureus chp protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP746696SKV could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP746696SKV could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage