All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule

Recombinant Staphylococcus aureus Enterotoxin type A (entA), partial

In Stock
Code CSB-EP362952FKZ1
MSDS
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
entA
Uniprot No.
P0A0L2
Research Area
Cell Biology
Alternative Names
entAEnterotoxin type A; SEA
Species
Staphylococcus aureus
Source
E.coli
Expression Region
25-253aa
Target Protein Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
30.5
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Troubleshooting and FAQs
Protein FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Related Products

entA antibodies

entA Proteins

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, waves of cellular activation, cytokine production, and migration into the lung tissue and airways occur via alphabeta T-cells. Causes also the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death (Probable).
Subcellular Location
Secreted.
Protein Families
Staphylococcal/streptococcal toxin family
Promotions
Obtain Rewards by Referring A Friend
Reward For Reviews
Transmembrane Protein Questionnaire with Gifts
Free antibody trial
Contact Us

  Email: [email protected]
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
TWIK2 channel mediates inflammation, study finds SWISS-PROT: When and How to Use It Osteoprotegerin (OPG): What is Its Potential as a Biomarker or Therapeutic Target? Oncogenes and Cancer GPC3: The Next-Promising Target in Cancer Immunotherapy Claudin 18.2, is a 'Dark Horse' in Anti-tumour Therapy? What Are Histones: Unraveling Their Critical Roles in Disease Pathogenesis Decoding the Biological Complexity of Endometrial Cancer: Essential Insights for Researchers Melanoma, the Most Serious Type of Skin Cancer Non-Hodgkin's Lymphoma, One of Common Heterogeneous Malignant Tumors Streptococcus pneumoniae, a Primary Cause of Pneumonia MUC16 (CA125): a Promising Predictive Marker and Therapeutic Target in Cancer Two Types of Macrophages: M1 and M2 Macrophages EGFR and Its Application in Cancer Therapy An Overview of Cell Death: Necrosis and Apoptosis The Overview of One Category of Important Cell Receptors: Receptor Tyrosine Kinases Cross-reactivity of Antibody: Beneficial or Harmful? GCGR: A Regulator of Energy Balance Holds a Potential in Treatment Diabetes TNFR1: A Multifaceted Molecule in Cancer, Another Promising Therapeutic Target for COVID-19 NRG1: an Intriguing Therapeutic Target in Diseases Approaches to Determinate Protein Concentration CCR8: a Specific Marker on Tregs Cells, the Next Promising Candidate for Antitumor Drugs! C5AR1: A Potential Molecule of Complement System to Fuel COVID-19 Therapy! 2021 Insights on the CAR-T Cell Therapy: the Most Popular Targets for Solid Tumor! Cellular Senescence and Its Markers How to Properly Reconstitute Lyophilized Proteins? DLL3: A New Molecular Target in Cancer Does LIF Only Play a Role in Leukaemia? How to Choose? Polyclonal, Monoclonal, or Recombinant Antibody? DNA Damage and Repair Chemokine Receptor CCR4: the Key Role of CCR4+Treg Cells in Cancer Immunotherapy DT3C, a Powerful Tool for ADC Drug Internalization In Vitro CLDN6: A "New Favorite" in Targeted Cancer Therapy after CLDN 18.2! CLDN9: Another Key Regulator for Tumors or Hearing Loss from the CLDN Family! DDR1: a Novel Member of the RTKs Family, a Potential Target for Tumor Therapy! RSPO1: The key factor determining "battle of the sexes " is “favored” in the culture of organoids? How to Validate An Antibody？ TPBG/5T4: the Oncofetal Protein, an Appealing Target for ADC or Vaccine Therapeutics in Tumors! CD93, A Rising Star in Anti-Tumor Therapy A Review of A Human NGAL ELISA Kit Intestinal Mucosal Barrier Bodyguard --ALPi The Collection of Progress of Anti-GPCR Antibody Drugs Dual Role of TNFRSF14 in Immunology With the High Potential in Cancer Immunotherapy, CD40 Is Triggering Attention CD31- A Complex Function Molecule CD14, A Membrane Receptor for Bacterial Lipopolysaccharides Surface Markers That Help You Identify Lymphocytes How Do You Get Exosomes? CAR-T Cell Therapy- An Useful Treatment To Cancer Exploring Biological Landscape of Cervical Cancer: A Comprehensive Overview for Researchers CLDN4: A Potential Prognostic Indicator and Therapeutic Target in Tumors！ What Are the Best Methods for Protein Purification? A Practical Guide CD19-The Most Popular Target with CAR T-Cell Therapy TFR1 (TFRC): a Stimulator of Fe Transport Affects Anemia, Neurodegenerative Disorders and Cancers! A Comprehensive Overview of Ovarian Cancer Categories over 10000! --Rare diseases that are no longer Protein Phosphorylation: The Dynamic Language of Cellular Regulation Tuberculosis--A Resurgent Differentiation of Th17 Cells A Review of WFDC8 Antibody ULBP1: a Potent Member of NKG2D Ligands in CAR-T Therapy for Multiple Hematological and Solid Tumors! How to Choose the Loading Control Antibodies? GFRAL: A Promising Metabolic Target for Improving Obesity and Anorexia/Cachexia Microglial Markers: Insights into Microglial Activation and Function Knowledge about Transthyretin Homeobox Transcription Factor- NANOG How to Inquire and Utilize the Signal Pathway on KEGG Costimulatory/Coinhibitory: Is B7-H3 An Enemy or A Friend? The Overview of Fc Receptors- Classification, Related Signaling Pathways and Application Effects of FSHR on Fertility and Tumors The Overview of Recombinant Antibody DSG2: a Vital Member of Desmosomal Cadherin Family, an Exciting New Target for Cardiomyopathy, Adenovirus, and Tumors! How to Choose the Right Secondary Antibody? Glial Fibrillary Acidic Protein - Astrocyte Specific Marker MYL9: a New Member of Myosin Motors, a Key Driver of Cancer Cell Dynamic Regulation? New Mechanism, NRP1 Enhances the Ability of SARS-CoV-2 Infection Surface Markers of Mesenchymal Stem Cells Oct4 -- The Gatekeeper of Pluripotency of Embryonic Stem Cells Interleukin 4 receptor (IL-4R/IL-4Ra): a Multifunctional Target of Cytokines, Suggesting Diverse Potential in Asthma, Rhinitis, Viral, and Tumor Research! Leukemia, Why is it So Common? CEACAM8: a Member of CEA Family, Emerging as a Vital Player in Gynaecological or Gastrointestinal Cancer Research! The Overview of Cell Viability Stem Cell-What a Miraculous Resource in Human Body IL-6-Do You Really Know That? Growth Hormone - Not Only Promotes Height Increase CEACAM5: A Promising Member of CEACAM Family, A Potential Target for ADC Drug Research! Nanobody, what a Powerful Novel Antibody! What Do You Need to Know Before Researching Human Metapneumovirus? CD147, a New Target of SARS-CoV-2 Invasion DKK1: a Well-Characterized Wnt Inhibitor, a Multifunctional Regulator in Multiple Cancers! One World, One Hope——What Can We Do about AIDS? Toll-like Receptors--The Eye of Innate Immunity The difference between primary antibody and secondary antibody A Comprehensive Exploration into Amyotrophic Lateral Sclerosis CD46, A Complement Regulator ACVRL1 (Alk1): a Member of the TGF-β Receptor Family, a Novel Target for Anti-Angiogenic Drug Research! Do you Often Trouble in These Problems of ELISA? The Meaning of Irregular Antibody Screening What Factors Could Affect ELISA Results? CD47, A New Target for Tumor Immune A "trembling" Parkinson's Disease Focus on Emerging Therapeutic Targets BCMA What Are Immune Checkpoint Pathways? Hematopoietic Stem Cell Surface Marker CD20 Monoclonal Antibodies Drugs: There is an Explosion of New mAbs Against CD20! Tumor Necrosis Factor Receptor Superfamily and Apoptosis The Power and Promise of Stable Cell Lines Understanding of Serum Albumin VSIG4: a Prominent B7 Family Costimulatory Molecule or Complement Receptor in Cancers and Inflammatory Diseases! Monoclonal Antibody Drugs Overview SLC39A6/ZIP6: a Key Member of Zinc Transporters, a Novel Targeting Antigen of ADC! What You Have To Know about Lung Cancer TMEFF2: a Tumor-Specific Methylated Biomarker, a Novel Target in Multiple Cancers Protein Kinases Overview: Definition, Types, Function, Activation Mechanism, etc. The Overview of Hippo Signaling Pathway Exploring Neurodegeneration: A Comprehensive Guide for Researchers The Recently Emerged New Swine Influenza Virus -- G4 EA-H1N1 CD44- A Powerful Bridge Between Cells Tools You Need For Fundamental Research What Powerful Model Organism Databases How to Measure Histone Modification? Unraveling the Dynamic World of Histone Modifications: Implications in Gene Regulation and Disease Pathogenesis Identify Treg Cells. You Can Do This. The Multifunctional Enzyme CD38: A Target for Immunotherapeutic Approaches in Cancer About Thyroid Tumor, This Information You Must Know! What Essential Biological Knowledge is Needed for Hepatocellular Carcinoma Research? These Tumor Databases You Have To Know CD146, A Powerful Tumor Marker GPCR Drugs Discovery Introduction of Hepatocellular Carcinoma Related Signaling Pathways SIGIRR: A Novel Member of the TIR Superfamily Acts as the Anti-Inflammatory 'Brake' to Control Immune Response in Various Diseases! Mesothelin: A Rising Star of Cancer Immunotherapy CD70 (CD27L/TNFSF7): a TNF Receptor Member, a “Star” Target for Clinical Research in Systemic Lupus Erythematosus (SLE), Arthritis, and Tumors! Diabetes: What You Need to Know Before Starting Research? PD-1-- An Important Immune Checkpoint CRTAM: Class I Restricted T cell-associated Molecule, an Intriguing New Member of the Ig-SF Family! An Overview of CD226 and Its Promising Role in Cancer Immunotherapy TROP2, An Important Target for Cancer Research CD Antigens - From Leucocytes Surface Markers to Diagnostic Markers for Cancer GLP-1R: An Energy Metabolism Regulator of GPCR Family, an Effective Drug Target for Type 2 Diabetes Therapy! TASIN represents a promising approach for prevention of colorectal cancer Latest Changes in Journal Impact Factor TM4SF1: a Member of the Transmembrane-4-Superfamily (L6), a New Vascular Therapeutic Target? Surface Markers of Natural Killer Cells What Is an Antibody? LY6G6D (LY6-G): A New Member of Lymphocyte Antigen-6 Family Holds Big Opportunities in Bispecific Antibody for CRC Treatment! Exploring the Science of Influenza A Virus: What You Need to Know Mucin-17/MUC17: An Unexpected Target for Tumor Immune Therapy, Notably Gastric Cancer! ANGPT2 (Ang-2): the First Bispecific Antibody for Eye Vision Loss Therapy, a Novel Target for Tumor Angiogenesis! 11 tips for choosing your right ELISA kit The Overview of Chemokine Norwalk Virus Analysis of Factors Influencing ELISA Detection IL-17A: A Major Cytokine of the IL-17 Family, a Key Inflammation Target in Skin Diseases, or Inflammation-Associated Cancers! ALPG: a Germ Cell-Associated Alkaline Phosphatase (ALP), a Highly Specific Cell Surface Antigen in Cancers! CUSABIO's Five Expression Systems Myosin Regulatory Light Chains (MYL12A and MYL12B): the New Functional Ligands for CD69, Potential Targets for Cardiac Disease or Tumors Research? FAP may be a drug target for pancreatic cancer The Overview of Colony Stimulating Factors Do You Really Know Neurons and Glia Cells in Nerve System? Apoptosis mediated by mitochondria Apoptosis mediated by endoplasmic reticulum Inhibition of ASCT2 combats cancer in vitro and in vivo Aesthetic Appreciation of Apoptosis Signal Pathway Get An Overview of His-Tag CD69: a Classical Early Marker of Lymphocyte Activation, a Pivotal Regulator of Hematologic Diseases and Autoimmune Disorders! PD-1/PD-L1, What a Powerful Immune Checkpoint EphA3-A Regulator of Cell Adhesion and Migration Cadherin-17 (CDH17): A Viable Target in Bispecific Antibodies or CAR-T Therapy to Fight Many Gastrointestinal Cancers! Itaconate is a negative regulator of inflammation The Memory thief - Alzheimer's disease The Overview of Growth Factor Tumor Necrosis Factor (TNF) The Overview of Interferon Tumor markers The Overview of Interleukin The Overview of Organelles The Overview of Autophagy How to Choose an Antibody for Scientific Research? Production of Recombinant Protein The Overview of Phage Display：Protocol, Classification, Application and FAQs Crosstalk Between Autophagy and Apoptosis TTR: an Important Protein of Amyloidosis, Novel Therapies are Upcoming for Rare Diseases ATTR-CM and ATTR-PN! The overview of Wnt signaling pathway The overview of TGF-β signaling pathway The Encyclopedia of Common Virus PI3K-Akt Signaling Pathway and Cancer Double-Edged Sword: TGF-β Do You Really Know TGF-β Superfamily? CCR9: A Member of the Chemokine Receptor Family, an Emerging Target for Numerous Tumor Researches! Chemokine Receptor CCR6: the Specific Receptor for CCL20, a Potential Target for Drug Research in Inflammatory Diseases and Gastrointestinal Cancer! CEACAM6: a Potent CEA Family Molecule, a New Tumor Marker or Anti-Cancer Target! What Is Tomato Mosaic Virus IL2RA (CD25): A Specific Marker of Tregs Functions as Both Immune Modulators and Targeted Agents in Various Diseases! Bispecific Antibody Overview: From Definition to Application The Review of Post-translational Modifications IGFL1: A Novel Secretory Protein of IGF-Like Family Presents a High Cancer-Promoting Potential! CXCR4: An Attractive Target of GPCR family Brings Promising New Drugs for Cancer Therapy！ CLDN3: Another Tight Junction Protein or New Drug Target, Interest in CLDN Family is Growing Fast! PROM1 (CD133): A New Cell Surface Marker of Cancer Stem Cells (CSCs), A More Significant Target for Immunotherapy! BDCA2/CLEC4C: a Novel Plasma Cell-Like Dendritic Cell (pDC) Marker and Potent Inhibitor of IFN-I that Blocks SLE Development! ENPP3 (CD203c): An Extracellular Enzyme, a Regulator for Nucleotide and Energy, an Indicator for Allergies, an Effective Target for RCC Therapy! ROR1, an Emerging Target for Tumor Immunotherapy SEMA4D/CD100: As an Important Immunoregulator to Improve Immunotherapy SSTR2: A Prominent Target in SSTR Family, Offers a More Precise Therapy in Neuroendocrine Tumors (NET) CADM1: an Immunoglobulin Superfamily Molecule, a New Tumor Suppressor Gene! CNR1 (CB1): A Crucial Receptor of Endocannabinoid System Offers Potential Treatments for Tumors and Glycolipid Metabolism Disorders! DSG3: An Emerging Tumor-Associated Adhesion Factor, a Specific Marker for the Clinical Diagnosis of Pemphigus Vulgaris (PV)! MAGEA4: a Member of the Melanoma-Associated Antigen (MAGE) Family, a Popular Target for Tumor-Specific Immune Research! In Vivo vs. In Vitro: Choosing the Right Experimental Model for Your Research Exploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing It IL-6: an Important Participant in the Inflammatory Cascade, One of the Most Functional Cytokines in Various Diseases Research! CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
[email protected]
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*