Home
Protein
Recombinant Protein
Recombinant Staphylococcus aureus Peptide deformylase (def)

Recombinant Staphylococcus aureus Peptide deformylase (def)

^{In Stock} ^Promotion

Code	CSB-EP017707FKZ
MSDS	MSDS
Size	US$388
	Order now
Promotion
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

def

Uniprot No.

P68826

Research Area

Others

Alternative Names

def; def1; pdf1Peptide deformylase; PDF; EC 3.5.1.88; Polypeptide deformylase

Species

Staphylococcus aureus

Source

E.coli

Expression Region

1-183aa

Target Protein Sequence

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.6kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I have purchased your E. coli expressed def recombinant protein (cat#: CSB-EP017707FKZ; Lot#: 03380).I would like to develop a stable recombinant peptide deformylase. The half-life of this enzyme is really short (10 seconds) and I want to improve it.Do you have any information on how to increase the half-life?

Very nice to receive your inquiry. We're sorry but we haven't performed related experiment to study the half-life of this protein and haven't received any relevant feedback from other customers.
You has mentioned that "The half-life of this enzyme is really short (10 seconds)". What analysis did you do? How did you get this conclusion?
Here we provide a literature for your reference. Here is the link: http://europepmc.org/articles/PMC2312423

Target Background

Function

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Protein Families

Polypeptide deformylase family

Promotions