Recombinant Tityus bahiensis Toxin Tb2-II

In Stock
Code CSB-EP350784TEQ
Product Type Recombinant Protein
Size EP: USD783
Uniprot No. P60276
Storage Buffer Tris-based buffer,50% glycerol
Species Tityus bahiensis(Brazilian scorpion)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC
Research Area Others
Source E.coli
Gene Names N/A
Protein Names Recommended name: Toxin Tb2-II
Expression Region 1-62aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 12.0 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing (By similarity). This toxin is active against both mammals and insects.
Subcellular Location Secreted
Protein Families Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity Expressed by the venom gland.

Related Products

N/A Proteins

N/A Proteins for Tityus bahiensis (Brazilian scorpion)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.