Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1


In Stock
Code CSB-EP323347TON
Product Type Recombinant Protein
Size EP: USD781
Uniprot No. P15226
Storage Buffer Tris-based buffer,50% glycerol
Species Tityus serrulatus(Brazilian scorpion)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Research Area Others
Source E.coli
Gene Names N/A
Protein Names Recommended name: Beta-mammal/insect toxin Ts7Alternative name(s): Tityustoxin VII Short name= Ts VII Short name= TsTX-VII Toxin II-11 Toxin III-10 Toxin T2-IV Toxin gamma Ts1
Expression Region 21-81aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 14.3 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. In addition, it stimulates the release of NO, IL-6 and TNF-alpha in J774.1 cells
Subcellular Location Secreted
Protein Families Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity Expressed by the venom gland.

Related Products

N/A Proteins

N/A Proteins for Tityus serrulatus (Brazilian scorpion)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.