Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1

In Stock
Code CSB-EP323347TON
Abbreviation Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
; Beta-mammal/insect toxin Ts1; PT-Mice-Ins-beta NaTx6.1; Tityustoxin VII; Ts VII; Ts7; TsTX-VII; Toxin II-11; Toxin III-10; Toxin T2-IV; Toxin gamma; TsTX-I
Species
Tityus serrulatus(Brazilian scorpion)
Source
E.coli
Expression Region
21-81aa
Target Protein Sequence
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland.
Subcellular Location
Secreted.
Protein Families
Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*