Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

ORF4

Uniprot No.

P11690

Research Area

Others

Alternative Names

19 kDa symptom severity modulator

Species

Tomato bushy stunt virus (strain Cherry) (TBSV)

Source

E.coli

Expression Region

1-172aa

Target Protein Sequence

MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESNVSRGCPEGTETFEKESE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.0 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged and C-terminal CBD-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Binds to short interfering RNAs (siRNAs) with high affinity. Acts as a molecular caliper to specifically select siRNAs based on the length of the duplex region of the RNA.

Gene References into Functions

Both observed variation and potential variation (where a non-synonymous change to p19 would be synonymous for the overprinted movement protein) does not significantly impact protein structure or RNA binding. PMID: 26871901
Data indicate that p19 exhibits size-specific and sequence-independent binding of its small RNA ligand. PMID: 23376479
The results demonstrate that transient co-transformation of plant cell suspension culture with two transformation vectors is feasible and that the use of the viral suppressor of silencing p19 significantly raises the production of the protein of interest. PMID: 20859930
involved in suppression of posttranscriptional gene silencing, virus movement, and symptom induction. PMID: 15299117
activity hindered by defective interfering RNA PMID: 15596838
This is the first clear demonstration of a direct correlation between a novel structurally orchestrated siRNA binding of an RNAi suppressor, P19 protein, and its roles in viral pathogenesis. PMID: 16501109
Substitutions on P19 that compromised siRNA binding not only affected systemic invasion and symptom development but also resulted in newly recognized effects on the integrity of virus and host material in a plant species-dependent manner. PMID: 19052093
P19 suppresses a common step in RNA silencing (innate immunity) that is downstream of small RNA maturation PMID: 19122141

Hide All

Protein Families

Tombusviruses protein p19 family

Database Links

KEGG: vg:1493957

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP320894TGA
Abbreviation	Recombinant Tomato bushy stunt virus ORF4 protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Tomato bushy stunt virus RNA silencing suppressor p19 (ORF4)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage