Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

tst

Uniprot No.

P06886

Alternative Names

tstToxic shock syndrome toxin-1; TSST-1

Species

Staphylococcus aureus

Source

E.coli

Expression Region

41-234aa

Target Protein Sequence

STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

37.9kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Delve into cutting-edge immunological research with our Recombinant Staphylococcus aureus tst. This product features Toxic shock syndrome toxin-1 (TSST-1), a potent exotoxin known for its involvement in toxic shock syndrome, one of the severe outcomes of Staphylococcus aureus infections. TSST-1 is recognized for its superantigenic properties, stimulating T-cell proliferation and cytokine release, which provides an exciting avenue for immunological and infectious disease research.

This recombinant protein covers the full length of the mature TSST-1, specifically the amino acid region from 41-234. It's expressed in E.coli, and it carries an N-terminal 6xHis-SUMO-tag for ease in purification and detection. Quality is assured, as the Recombinant Staphylococcus aureus tst shows a purity greater than 90%, as determined by SDS-PAGE. Depending on your research needs, the product comes as a liquid solution or as a lyophilized powder. This product is an excellent choice for research focusing on Staphylococcus aureus pathogenicity, superantigen behavior, and immune responses.

Code	CSB-EP361973FKZ
Abbreviation	Recombinant Staphylococcus aureus tst protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1 (tst)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage