Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

GRA3

Uniprot No.

B6KEU8

Research Area

Signal Transduction

Alternative Names

GRA3; Tg556; Dense granule protein 3; P30

Species

Toxoplasma gondii

Source

E.coli

Expression Region

43-114aa

Target Protein Sequence

ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

10.8 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 43-114 constitute the expression domain of recombinant Toxoplasma gondii GRA3. The theoretical molecular weight of the GRA3 protein is 10.8 kDa. This GRA3 protein is produced using e.coli expression system. The GRA3 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant GRA3 protein during the following stages.

Toxoplasma gondii dense granule protein 3 (GRA3) is a protein involved in the early stages of infection and is believed to play a role in the modulation of the host cell environment. It may contribute to the formation and maintenance of the parasitophorous vacuole. GRA3 is recognized by the host immune system, leading to the production of antibodies during T. gondii infection. It is considered a potential target for vaccine development. The immune response against GRA3 is part of the host defense mechanism against T. gondii. Understanding the interaction between GRA3 and the host immune system provides insights into the pathogenesis of toxoplasmosis.

Target Background

Function

Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM.

Subcellular Location

Cytoplasm. Host endoplasmic reticulum. Parasitophorous vacuole membrane; Multi-pass membrane protein.

Code	CSB-EP467284TOV1
Abbreviation	Recombinant Toxoplasma gondii GRA3 protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage