Recombinant Toxoplasma gondii Dense granule protein 6 (GRA6), partial

In Stock
Code CSB-EP631656TOV1e0
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GRA6
Uniprot No.
Research Area
Others
Alternative Names
GRA6; TG24; Dense granule protein 6; Protein GRA 6; Antigen p32; Protein p33
Species
TOV-Toxoplasma gondii
Source
E.coli
Expression Region
35-150aa
Target Protein Sequence
NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
38.6 kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process for recombinant TOV-Toxoplasma gondii GRA6 protein synthesis in e.coli cells includes recombining the DNA fragment that encodes the TOV-Toxoplasma gondii GRA6 protein (35-150aa) into expression vector, transforming the recombinant vector into e.coli cells, screening positive cells, cultivating and inducing cells, conducting cell lysis, and performing expression analysis. The resulting recombinant TOV-Toxoplasma gondii GRA6 protein is purified from the cell lysate using affinity purification, with its purity exceeding 85% as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major granular component involved in excreted-secreted antigen (ESA) immunity. May have a structural role in the membranous network of the parasitophorous vacuole (PV).
Subcellular Location
Secreted. Parasitophorous vacuole lumen. Parasitophorous vacuole membrane. Cytoplasmic vesicle, secretory vesicle. Note=Located in dense granules of tachyzoites. Upon infection, secreted into the parasitophorous vacuole (PV) and targeted to the microvillus membranous network.
Protein Families
Gra6 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*