Recombinant Vaccinia virus Protein A33(A33R),partial

Code CSB-BP300755VAA1
Product Type Recombinant Protein
Size US$2956
Uniprot No. P68616
Storage Buffer Tris-based buffer,50% glycerol
Species Vaccinia virus (strain Copenhagen) (VACV)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
Research Area Others
Source Baculovirus
Gene Names A33R
Protein Names Recommended name: Protein A33
Expression Region 57-185aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 18.3
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles (By similarity).
Subcellular Location Virion membrane, Single-pass type II membrane protein, Host membrane, Single-pass type II membrane protein
Protein Families Chordopoxvirinae A33 protein family

Related Products

A33R Proteins

A33R Proteins for Vaccinia virus (strain Copenhagen) (VACV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.