Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L), partial

In Stock
Code CSB-EP806333VBE
Abbreviation Recombinant Vesicular stomatitis Indiana virus L protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
L
Uniprot No.
Research Area
others
Alternative Names
L; RNA-directed RNA polymerase L; Protein L; Large structural protein; Replicase; Transcriptase) [Includes: RNA-directed RNA polymerase; EC 2.7.7.48); mRNA; guanine-N(7)-)-methyltransferase; EC 2.1.1.56); GDP polyribonucleotidyltransferase; EC 2.7.7.88); Cap-specific mRNA; nucleoside-2'-O-)-methyltransferase 2; EC 2.1.1.296)]
Species
Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV)
Source
E.coli
Expression Region
598-784aa
Target Protein Sequence
ICIANHIDYEKWNNHQRKLSNGPVFRVMGQFLGYPSLIERTHEFFEKSLIYYNGRPDLMRVHNNTLVNSTSQRVCWQGQEGGLEGLRQKGWSILNLLVIQREAKIRNTAVKVLAQGDNQVICTQYKTKKSRNVVELQSALNQMVSNNEKIMTAIKIGTGKLGLLINDDETMQSADYLNYGKIPIFRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L) comes from expression in E. coli and includes an N-terminal 6xHis-tag that makes purification and detection more straightforward. The protein covers a partial region—amino acids 598 to 784—and shows purity above 85% when checked by SDS-PAGE analysis. This product is meant for research use only and comes without any guaranteed biological activity.

The RNA-directed RNA polymerase L of Vesicular stomatitis Indiana virus plays a central role in how the virus replicates and transcribes its genetic material. This protein acts as a key piece of the viral polymerase complex, handling the synthesis of viral RNA from RNA templates. Because of this critical function, it has become an important target for researchers studying how viruses replicate and for those looking into potential antiviral approaches. Learning more about how it works and what it interacts with could advance virology research in meaningful ways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L is a large, multifunctional viral enzyme that requires precise folding, complex domain interactions, and often partnership with other viral proteins (e.g., P protein) for its polymerase activity. The E. coli expression system cannot provide the eukaryotic-like folding environment or post-translational modifications necessary for this viral protein. The partial fragment (598-784aa) represents only a portion of the full-length protein and is unlikely to fold into a functional domain independently. The N-terminal His-tag may not significantly interfere, but the probability of correct folding and functional activity is low.

1. Antibody Development and Immunoassay Research

This recombinant L protein fragment serves as an excellent immunogen for generating antibodies against linear epitopes of VSV RNA polymerase. The defined sequence (598-784aa) allows for targeted antibody production. The His-tag facilitates purification and immobilization during antibody screening and validation in ELISA or Western blot assays.

2. ELISA-Based Binding Assays

This protein is well-suited as an antigen for ELISA to detect anti-L protein antibodies or for quantitative immunoassays. The His-tag enables consistent immobilization on nickel-coated plates. However, functional binding (e.g., with nucleic acids or viral partners) requires native folding. The protein's misfolded state makes it unreliable.

3. Western Blot Standard and Positive Control

This recombinant fragment is ideal as a positive control and molecular weight standard in Western blot analyses. The His-tag provides a detection handle, and the known size helps validate antibody specificity and assay conditions. The >85% purity ensures clear, interpretable bands.

Final Recommendation & Action Plan

This recombinant VSV L protein fragment is primarily suitable for immunological applications (antibody development and detection assays) but is unsuitable for functional interaction studies due to its partial length and high probability of misfolding in E. coli. The recommended approach is to prioritize Application 1 and 3 (Antibody Development and Western Blot Control) as they can proceed immediately. Application 2 (ELISA) should be limited to immunoassays only. Protein-protein interactions require a precise tertiary structure that this misfolded, partial fragment cannot provide. For functional VSV polymerase studies, use full-length protein expressed in eukaryotic systems (e.g., insect or mammalian cells) that support complex viral protein folding. 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for RNA synthesis (replicase and transcriptase), cap addition, and cap methylation. Performs also the polyadenylation of subgenomic mRNAs by a stuttering mechanism at a slipery stop site present at the end of viral genes. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, thereby initiating either genome replication or mRNA transcription. In the transcription mode, the polymerase performs the sequential transcription of all mRNAs using a termination-reinitiation mechanism responding to gene start and gene end signals. Some polymerase disengage from the template at each gene junction, resulting in a decreasing abundance of transcripts from the 3' to the 5' end of the genome. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein helps the polymerase to engage the N-RNA template and acts as processivity factor. Polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. In the replication mode, the polymerase replicates the whole viral genome without recognizing the gene end transcriptional signals. The ability of the polymerase to override the gene end signals as it is producing the antigenome is probably due to replicative RNA becoming encapsidated with nucleoprotein as it is synthesized.
Subcellular Location
Virion. Host cytoplasm.
Protein Families
Rhabdoviridae protein L family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*