Recombinant Zoarces americanus Ice-structuring protein lambda OP-3

Code CSB-EP325687MAQ
Product Type Recombinant Protein
Size US$2466
Uniprot No. P19606
Relevance Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP325687MAQ could indicate that this peptide derived from E.coli-expressed Zoarces americanus (Ocean pout) (Macrozoarces americanus) N/A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP325687MAQ could indicate that this peptide derived from E.coli-expressed Zoarces americanus (Ocean pout) (Macrozoarces americanus) N/A.
Storage Buffer Tris-based buffer,50% glycerol
Alias Antifreeze protein lambda OP-3
Species Zoarces americanus (Ocean pout) (Macrozoarces americanus)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN
Research Area Others
Source E.coli
Protein Names Recommended name: Ice-structuring protein lambda OP-3 Short name= ISP lambda OP-3 Alternative name(s): Antifreeze protein lambda OP-3
Expression Region 23-91aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity).
Subcellular Location Secreted
Protein Families Type-III AFP family

Related Products

Antibodies

Antibodies for Zoarces americanus (Ocean pout) (Macrozoarces americanus)

Proteins

Proteins for Zoarces americanus (Ocean pout) (Macrozoarces americanus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.