Recombinant human Sulfotransferase 1A3/1A4

Code CSB-EP022935HUe0
Product Type Recombinant Protein
Size US$1726
Uniprot No. P0DMM9
Relevance Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Aryl sulfotransferase 1A3/1A4 Catecholamine-sulfating phenol sulfotransferase HAST3 M-PST Monoamine-sulfating phenol sulfotransferase Placental estrogen sulfotransferase Sulfotransferase 1A3/1A4 Sulfotransferase, monoamine-preferring Thermolabile phenol sulfotransferase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Research Area Neuroscience
Source E.coli
Gene Names SULT1A3
Expression Region 1-295aa
Tag Info N-terminal GST-tagged
Mol. Weight 61.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.
Subcellular Location Cytoplasm
Protein Families Sulfotransferase 1 family
Tissue Specificity Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte.
Database Links

HGNC: 11455

OMIM: 600641

KEGG: hsa:105369243

STRING: 9606.ENSP00000343645

UniGene: Hs.460558

Related Products

SULT1A3 Antibodies

SULT1A3 Antibodies for Human

SULT1A3 Proteins

SULT1A3 Proteins for Homo sapiens (Human)

SULT1A3 ELISA Kit

SULT1A3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.