Recombinant Alligator mississippiensis Rhodopsin(RHO)

Code CSB-CF019681AZO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P52202
Storage Buffer Tris-based buffer,50% glycerol
Species Alligator mississippiensis (American alligator)
Sequence MNGTEGPDFYIPFSNKTGVVRSPFEYPQYYLAEPWKYSALAAYMFMLIILGFPINFLTLY VTVQHKKLRSPLNYILLNLAVADLFMVLGGFTTTLYTSMNGYFVFGVTGCYFEGFFATLG GEVALWCLVVLAIERYIVVCKPMSNFRFGENHAIMGVVFTWIMALTCAAPPLVGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFAIPLAVIFFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVSFLICWVPYASVAFYIFSNQGSDFGPVFMTIPAFFAKSSAI YNPVIYIVMNKQFRNCMITTLCCGKNPLGDDETATGSKTETSSVSTSQVSPA
Source in vitro E.coli expression system
Gene Names RHO
Protein Names Recommended name: Rhodopsin
Expression Region 1-352
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity
Subcellular Location Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in rod-shaped photoreceptor cells in the retina that mediate vision in dim ligh (at protein level).
Database Links

KEGG: amj:102559120

Related Products

RHO Proteins

RHO Proteins for Alligator mississippiensis (American alligator)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.