Recombinant Anolis carolinensis Rhodopsin(RHO)

Code CSB-CF019681AKP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P41591
Storage Buffer Tris-based buffer,50% glycerol
Species Anolis carolinensis (Green anole) (American chameleon)
Sequence MNGTEGQNFYVPMSNKTGVVRNPFEYPQYYLADPWQFSALAAYMFLLILLGFPINFLTLF VTIQHKKLRTPLNYILLNLAVANLFMVLMGFTTTMYTSMNGYFIFGTVGCNIEGFFATLG GEMGLWSLVVLAVERYVVICKPMSNFRFGETHALIGVSCTWIMALACAGPPLLGWSRYIP EGMQCSCGVDYYTPTPEVHNESFVIYMFLVHFVTPLTIIFFCYGRLVCTVKAAAAQQQES ATTQKAEREVTRMVVIMVISFLVCWVPYASVAFYIFTHQGSDFGPVFMTIPAFFAKSSAI YNPVIYILMNKQFRNCMIMTLCCGKNPLGDEETSAGTKTETSTVSTSQVSPA
Source in vitro E.coli expression system
Gene Names RHO
Protein Names Recommended name: Rhodopsin
Expression Region 1-352
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Pineal gland. Instead of the rod where rhodopsin is generally located.
Database Links

STRING: 28377.ENSACAP00000014023

Related Products

RHO Proteins

RHO Proteins for Anolis carolinensis (Green anole) (American chameleon)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.