Recombinant Arabidopsis thaliana RING-H2 finger protein ATL5(ATL5)

Code CSB-CF881873DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9LZJ6
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MGNLFDSSKTLWGNMNHGSSRYSLNGKIMLASVIILFVAVILILCFHSYARWLFRRQNRR IRRRISAHLRSLAAARDPTQSSSSLSPLDPTVLEKIPIFVYSVKTHESPLEECSVCLSEF EEDDEGRVLPKCGHVFHVDCIDTWFRSRSSCPLCRAPVQPAQPVTEPEPVAAVFPSVKPI EDTEAGSSSSSDESESSTPSSSSGSPVRFPMEACEREPIDLVGIIVEIPREFQDSNSDLP ADNGSNRRASLKRLWII
Source in vitro E.coli expression system
Gene Names ATL5
Protein Names Recommended name: RING-H2 finger protein ATL5
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families RING-type zinc finger family, ATL subfamily
Database Links

KEGG: ath:AT3G62690

STRING: 3702.AT3G62690.1

UniGene: At.4826

Related Products

ATL5 Antibodies

ATL5 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

ATL5 Proteins

ATL5 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.