Recombinant Bovine Acyl-CoA desaturase (SCD)

Code CSB-CF879991BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
SCD; Stearoyl-CoA desaturase; Acyl-CoA desaturase; Delta(9-desaturase; Delta-9 desaturase; Fatty acid desaturase
Species
Bos taurus (Bovine)
Expression Region
2-359
Target Protein Sequence
PAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQD KEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAHR LWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDET FQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation. Plays an important role in body energy homeostasis. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides.
Gene References into Functions
  1. Expression of SCD1 was downregulated through reduced transcription and abundance of the transcription factor sterol regulatory element-binding protein 1 (SREBP1c).This effect was augmented by local chromatin tightening and DNA methylation at and around the SREBP1c binding site in the SCD1 promoter PMID: 29274956
  2. It plays important roles in growth and lipid metabolisms. PMID: 29154485
  3. E. coli mastitis reduced SCD1 expression in liver and udder. PMID: 27439381
  4. Here, the association between DGAT1 K232A, SCD1 A293V, and LEPR T945M markers with milk fat composition in southern Chile was evaluated. The most frequent variants for DGAT1, SCD1, and LEPR polymorphisms were GC/GC, C, and C, respectively. The SCD1 CC genotype was associated with a low cholesterolemic FA content, a high ratio of linolenic acid to cholesterolemic FA, and lower conjugated-linolenic acid and PUFA content. PMID: 27173340
  5. significant effects of the SCD gene on milk medium- and long-chain unsaturated fatty acids, especially for C14:1 and C14 index in dairy cattle PMID: 26970560
  6. Studied the responsiveness of bovine SCD1 promoter to serum, insulin, oleic acid, and NFY transcription factor in BME-UV1 cells. PMID: 26158455
  7. The results suggest that a mutation of SCD1, but not LEPR or ABCG2, might be useful as a DNA marker to decrease reproductive problems and improve production traits in Iranian Holstein dairy cows. PMID: 25130486
  8. Suppression of CPT1B and induction of SCD and CEBPB by supplemental arginine promotes increased adiposity in Angus steers. PMID: 24327170
  9. This study showed that milk somatic cells can be used as a source of mRNA to study SCD1 expression in dairy cows, offering a non-invasive alternative to mammary tissue samples obtained by biopsy. PMID: 22369625
  10. This study presents evidence that there are breed- and diet-induced variations on lipid metabolism in the muscle, which may be, at least partially, modulated by the stearoyl-CoA desaturase (SCD) gene expression levels. PMID: 23467818
  11. effects of A293V polymorphism on milk fat composition in winter and summer PMID: 23127906
  12. These results provide detailed genetic information for the SREBP1 signalling pathway and SCD that can be used to change milk fat composition by marker-assisted breeding. PMID: 22114848
  13. study evaluated the contributions of polymorphisms of FASN and SCD genes on fatty acid composition in muscle in two different populations: 1189 and 1058 Japanese Black cattle from the Miyagi and the Yamagata populations PMID: 22497525
  14. Stearoyl-coenzyme A desaturase SNPs effect milk yield in the Chinese dairy population. PMID: 22722989
  15. Results suggest that SCD and FASN are strong candidate genes influencing fatty acid composition in beef cattle. PMID: 22221030
  16. The expression of the stearoyl-CoA desaturase gene was higher in the adipose tissue of heifers compared to bulls and gene expression is partly associated with adipose tissue fatty acid composition. PMID: 21640489
  17. It was concluded that, unlike essential fatty acids, the fatty acid composition of adipose tissue is regulated by adipose tissue fatty acid desaturation, with little contribution from hepatic or duodenal fatty acids. PMID: 21454869
  18. The effects of genetic polymorphisms of liver X receptor, alpha (LXR), stearoyl-CoA desaturase (SCD), Fatty acid synthase (FASN), and Fatty acid binding protein 4 (FABP4) were investigated on fatty acid composition in fat tissue of steers. PMID: 21615833
  19. This study confirms the fundamental role of SCD1 genes in transforming saturated fatty acids into monounsaturated fatty acids. PMID: 21145173
  20. Results describe the diet-induced effects of sustained upregulation of stearoyl-CoA desaturase on milk fat synthesis and lipogenic gene networks. PMID: 20607344
  21. The results of this study demonstrated the existence of the polymorphisms in the SCD1 and SREBP-1 genes in the population of Fleckvieh cattle and their associations with the concentrations of several muscle fat and subscutaneous fat fatty acids. PMID: 20374858
  22. SCD1 showed significant association with C14:1 cis-9 and C14:1 cis-9/C14:0, which is considered the best proxy of the desaturation activity in mammary gland PMID: 20105547
  23. no significant effect of the SCD1 variants on any of the reproductive traits PMID: 19841232
  24. SNPs in the 3'UTR of the SCD1 gene could therefore explain some of the within-breed variations in mono-unsaturated fatty acids content of milk fat. PMID: 19765166
  25. Sequences of scd promoter of cows producing high milk CLA compared with low CLA showed no polymorphisms in this promoter segment or among scd promoter of Holstein Friesian, Montbeliarde, Normande, Norwegian Red, Charlois, Limousin & Kerry breeds. PMID: 15834635
  26. A transcriptional enhancer element in the stearoyl-CoA desaturase promoter was identified and characterized. PMID: 16603123
  27. In this paper, we describe for the first time a second SCD isoform in cattle, which appears to be an ortholog of human SCD5 rather than a homolog of bovine SCD1 or any of the described murine SCD isoforms PMID: 17468887
  28. study concludes that the higher desaturase activity of SCD allele C in the composition of milk fat can only be appreciated on myristic and caproleic FA because of the different pathways from which milk FA derive PMID: 17582140
  29. Single nucleotide polymorphisms in the open reading frame of the SCD gene and resulting genetic variants in Canadian Holstein and Jersey cows are reported. PMID: 17654011
  30. results provide some indication of an association between Stearoyl-CoA desaturase (SCD) locus and the fatty acid profile in the milk of Italian Holsteins PMID: 17699067
  31. SCD mRNA levels were significantly increased 10.8 and 6.3-fold in cultured adipocytes from Japanese Black and Holstein, respectively. The difference in SCD expression may reflect differences in the fat development characteristics of the breeds. PMID: 17851104
  32. direct influence of SCD polymorphism on fatty acid composition of milk and beef PMID: 18254828
  33. selective breeding can contribute to higher unsaturation indices, and that selective breeding can capitalize on genotypic information of both stearoyl-CoA desaturase (SCD1)and diacylglycerol O-acyltransferase homolog 1(DGAT1)polymorphism PMID: 18420645
  34. a possible use of the SCD locus in gene-assisted selection programs for the improvement of milk production traits in dairy cattle PMID: 18650296
  35. The endogenous production of monounsaturated fatty acids is linked to the Delta(9)-desaturase activity PMID: 18650299
  36. Data show that SCD1 gene as a critical player in skeletal muscle fat metabolism. PMID: 18825276

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Fatty acid desaturase type 1 family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1