Recombinant Bovine C-X-C chemokine receptor type 2 (CXCR2)

Code CSB-CF632950BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CXCR2; IL8RB; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182
Species
Bos taurus (Bovine)
Expression Region
1-360
Target Protein Sequence
MTIILKDLSNSSILWEGFEDEFGNYSGTPPTEDYDYSPCEISTETLNKYAVVVIDALVFL LSLLGNSLVMLVILYSRIGRSVTDVYLLNLAMADLLFAMTLPIWTASKAKGWVFGTPLCK VVSLLKEVNFYSGILLLACISMDRYLAIVHATRTLTQKWHWVKFICLGIWALSVILALPI FIFREAYQPPYSDLVCYEDLGANTTKWRMIMRVLPQTFGFLLPLLVMLFCYGFTLRTLFS AQMGHKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAHVIAETCQRRNDIGRALDATE ILGFLHSCLNPLIYVFIGQKFRHGLLKIMAIHGLISKEFLAKDGRPSFVGSSSGNTSTTL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
  1. no statistically significant association of the SNP CXCR1+777 or CXCR1-1768 with SCS was found PMID: 19620685
  2. Data describe the expression of IL-8, IL-1beta and their respective receptors, CXCR1 and IL-1R1 in bovine theca cells, and suggest that VEGF is associated with the IL system in theca cells in ovary. PMID: 20156197
  3. The aim of this study was to demonstrate the presence of the two SNPs in the CXCR1 gene of Japanese Black cattle and examine the association between the SNPs and clinical diseases including intestinal and respiratory diseases in calves. PMID: 20697186
  4. Association between interleukin-8 receptor-alpha (CXCR1) polymorphism and disease incidence, production, reproduction, and survival in Holstein cows. PMID: 21426999
  5. The situation of CXCR1 polymorphisms in Chinese Holstein cattle and determine the relationship between the CXCR1 SNPs and mastitis resistance. PMID: 21774621
  6. highly polymorphic PMID: 22056270
  7. The results suggests the possible role of CXCR1 gene SNPs in the host response against mastitis. PMID: 23979897
  8. CXCR1 polymorphisms influence viability and concentration of milk polymorphonuclear neutrophilic leukocytes. PMID: 24934516
  9. The results demonstrate that CXCR1 polymorphism can influence somatic cell count and milk neutrophil viability following experimental mastitis. PMID: 25933826
  10. In the present study no association could be detected between superoxide production by isolated bovine neutrophils during early lactation and CXCR1 gene polymorphism. IL-8 showed to possess inhibitory effects on ROS generation in bovine neutrophils. PMID: 25944115
  11. Polymorphisms in CXCR1 are significantly associated with bovine mastitis PMID: 26126595
  12. (PCR) was used to detect the methylation status of CXCR1 CpG island, and quantitative fluorescence PCR was used to detect CXCR1 expression in bovine mammary tissue PMID: 26505411

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1