Recombinant Bovine Chemokine C-C motif receptor-like 2(CCRL2)

Code CSB-CF606583BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q0II78
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MANYTPAPEDDYDVFIEDDLSDDEIEPCTPYDPKILSAQLVPYLYTTVFMVGLLDNILVV FILVKYKGLRQAENMSFLNLALSNLGFLLTLPFWAYAASHGEGFDDPLCKILLLLYSIGL YSEAFFNVLLTVQRYKEFFHVRRRFSACRTVAGSIFISVLVWVTATLVTLPELVSYKPQM QSQKYKCFFTGLHFLPADETFWKHFLTLKMNILGFLLPLFAFVYCYVRMRKTLQFRERNY GLFKLVFTIMAVFLLMWGPYNIVLFLSAFNEHFSLHGCGSSYNLNKSVQITRIIAATHCC VNPLLYVFLDKAFRKHLCHLFYLCSDTAPQPTEEPAQGASGEEYHLSS
Source in vitro E.coli expression system
Gene Names CCRL2
Protein Names Recommended name: Chemokine C-C motif receptor-like 2
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptor. Plays a critical role for the development of Th2 responses (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: bta:515976

STRING: 9913.ENSBTAP00000008096

UniGene: Bt.46141

Related Products

CCRL2 Proteins

CCRL2 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.