Recombinant Bovine L-selectin (SELL)

Code CSB-CF020977BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
SELL; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; CD antigen CD62L
Species
Bos taurus (Bovine)
Expression Region
39-370
Target Protein Sequence
WTYHYSKRPMPWEKARAFCRENYTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEAKNWGAGEPNNRKSKEDCVEIYIKRNKDSGKWNDDACHKAKTALCYTASCKPWSCSGHGQCVEVINNYTCNCDLGYYGPECQFVTQCVPLEAPKLGTMACTHPLGNFSFMSQCAFNCSKGTDMIGVEETTCAPFGNWSSPEPTCRVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCSEEAELTGEKKTICGLSGNWSSPSPRCQKINRTISINEESDYNPLFIPVAVMVTAFSGLAFIIWLARRLKRKSKKVSEKHG
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
Gene References into Functions
  1. Five single nucleotide polymorphisms (SNPs) from different exons in selectin SELP, two in selectin SELL and one in selectin SELE were taken forward to genotyping in 337 Holstein Friesian heifers using PCR-RFLP. PMID: 28419109
  2. gammadelta T cells, the main recirculating subset in both afferent and efferent lymph, have high levels of CD62L cell surface expression. PMID: 22156593
  3. demonstrate the existence of central memory T cells (Tcm) in cattle and suggest that CD62L may serve as a marker to monitor Tcm in infections and vaccine development studies in ruminant. PMID: 19766669
  4. determined the effects of Mycobacterium-induced proliferation and apoptosis on CD25, CD44, and CD62L expression on peripheral blood T-cell subsets from M. bovis-infected cattle PMID: 12496181
  5. intramammarily administered lipopolysaccharides seem to play an important role in modulating L-selectin and beta2 integrin expression on circulating bovine polymorphonuclear leukocytes PMID: 12906050
  6. results indicate that glucocorticoid-induced suppression of L-selectin is likely mediated by direct effects of glucocorticoid receptor activation on intracellular reservoirs of L-selectin mRNA and protein, predominantly in blood neutrophils. PMID: 14761937

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Selectin/LECAM family
Tissue Specificity
Highly expressed in lymphocytes from peripheral lymph nodes. Low in lymphocytes isolated from Peyer patches.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1