Recombinant Bovine Leukotriene B4 receptor 1(LTB4R)

Code CSB-CF660996BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3T181
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Bos taurus (Bovine)
Sequence MNTTSPAAPSSSGVSFISLLVIIVLSVALAVGLPGNSFVVWSILAKLRKRSVTALMVLHL ALADLAVLLTAPFFLYSVAQGTWTFGLSSCRLFHYVCGVSMYASVLLIMTMSLDRSLAVA LPFVSQKLRTKAVAWRVLAGIWVMSVLLATPVLLYRTVHLGLNNRSLTCFLKYPSERHRA FHLFFEVITGFLLPFLVVVASYCDIGRRLRARRFRRSRRTGRLVALIILAFAAFWLPYHV VNLAEGFRAAAGKALGSGPVGRRLLLARHVLITLAFLSSSVNPLLYACAGGGLLRSAGVG FIAKLLEGTGSETSSSRRKGTLAQTLRGTPASPEPDPAESLTASTNPLE
Source in vitro E.coli expression system
Gene Names LTB4R
Protein Names Recommended name: Leukotriene B4 receptor 1 Short name= LTB4-R 1 Short name= LTB4-R1
Expression Region 1-349
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: bta:613482

STRING: 9913.ENSBTAP00000036335

UniGene: Bt.16889

Related Products

LTB4R Proteins

LTB4R Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.