Recombinant Bovine Long-wave-sensitive opsin 1 (OPN1LW)

Code CSB-CF858376BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
OPN1LW; RCP; Long-wave-sensitive opsin 1; Red cone photoreceptor pigment; Red-sensitive opsin
Species
Bos taurus (Bovine)
Expression Region
1-364
Target Protein Sequence
MAHAWGPQRLAGGQPQANFEESTQGSIFTYTNSNSTRDPFEGPNYHIAPRWVYHLTSAWM VFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLAETIIASTISVVNQMYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAITGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCFIPLSVIILCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAYCLCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDSSELSSVSKTEASSVSS VSPA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Gene References into Functions
  1. an extended network of hydrogen bonds connects the agonist retinal binding site to the G protein binding site via conserved amino acid residues. dynamics of the hydrogen-bonding network inside opsin couples to interactions at the G protein binding site PMID: 25138898
  2. instability of the retinitis pigmentosa P23H mutant opsin PMID: 24515108
  3. Ligand binding in opsin apparently follows an induced-fit three-point interaction model, with the ring, 9-methyl group, and aldehyde group as the determining selection elements. PMID: 15544351
  4. the crystal structure of ligand-free native opsin from bovine retinal rod cells at 2.9 angstrom (A) resolution PMID: 18563085
  5. 3.2 A crystal structure of the bovine Ops*-GalphaCT peptide complex PMID: 18818650
  6. Mammalian rod opsin biogenesis does not appear to have an absolute requirement for Cnx. PMID: 19116670
  7. a single dibasic degron motif is sufficient to initiate both the ER retention and subsequent degradation of ospin via an endoplasmic reticulum associated degradation pathway PMID: 19878048

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity
Expressed in retina (at protein level). Expressed in cone and/or rod photoreceptor cells (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1